© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|2238 |
| Gene name | |
| Location | Contig_152:25438..26289 |
| Strand | - |
| Gene length (bp) | 851 |
| Transcript length (bp) | 792 |
| Coding sequence length (bp) | 792 |
| Protein length (aa) | 264 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00227 | Proteasome | Proteasome subunit | 3.3E-28 | 38 | 193 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P23724|PSB6_YEAST | Proteasome subunit beta type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE7 PE=1 SV=1 | 21 | 263 | 1.0E-87 |
| sp|Q9UQY2|PSB6_SCHPO | Probable proteasome subunit beta type-6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pam1 PE=3 SV=1 | 30 | 263 | 7.0E-73 |
| sp|Q9IB83|PSB1B_CARAU | Proteasome subunit beta type-1-B OS=Carassius auratus GN=psmb1-B PE=2 SV=1 | 28 | 263 | 1.0E-70 |
| sp|Q9IB84|PSB1A_CARAU | Proteasome subunit beta type-1-A OS=Carassius auratus GN=psmb1-A PE=2 SV=1 | 28 | 263 | 1.0E-70 |
| sp|P20618|PSB1_HUMAN | Proteasome subunit beta type-1 OS=Homo sapiens GN=PSMB1 PE=1 SV=2 | 4 | 263 | 8.0E-69 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P23724|PSB6_YEAST | Proteasome subunit beta type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE7 PE=1 SV=1 | 21 | 263 | 1.0E-87 |
| sp|Q9UQY2|PSB6_SCHPO | Probable proteasome subunit beta type-6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pam1 PE=3 SV=1 | 30 | 263 | 7.0E-73 |
| sp|Q9IB83|PSB1B_CARAU | Proteasome subunit beta type-1-B OS=Carassius auratus GN=psmb1-B PE=2 SV=1 | 28 | 263 | 1.0E-70 |
| sp|Q9IB84|PSB1A_CARAU | Proteasome subunit beta type-1-A OS=Carassius auratus GN=psmb1-A PE=2 SV=1 | 28 | 263 | 1.0E-70 |
| sp|P20618|PSB1_HUMAN | Proteasome subunit beta type-1 OS=Homo sapiens GN=PSMB1 PE=1 SV=2 | 4 | 263 | 8.0E-69 |
| sp|P18421|PSB1_RAT | Proteasome subunit beta type-1 OS=Rattus norvegicus GN=Psmb1 PE=1 SV=3 | 14 | 263 | 5.0E-68 |
| sp|O09061|PSB1_MOUSE | Proteasome subunit beta type-1 OS=Mus musculus GN=Psmb1 PE=1 SV=1 | 22 | 263 | 8.0E-68 |
| sp|Q2TBX6|PSB1_BOVIN | Proteasome subunit beta type-1 OS=Bos taurus GN=PSMB1 PE=1 SV=1 | 4 | 263 | 3.0E-67 |
| sp|P40304|PSB1_DROME | Proteasome subunit beta type-1 OS=Drosophila melanogaster GN=Prosbeta6 PE=2 SV=2 | 33 | 263 | 1.0E-55 |
| sp|P42742|PSB1_ARATH | Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2 | 29 | 263 | 8.0E-54 |
| sp|O82531|PSB1_PETHY | Proteasome subunit beta type-1 OS=Petunia hybrida GN=PBF1 PE=2 SV=1 | 29 | 263 | 4.0E-48 |
| sp|Q86A21|PSB1_DICDI | Proteasome subunit beta type-1 OS=Dictyostelium discoideum GN=psmB1 PE=3 SV=1 | 23 | 263 | 2.0E-47 |
| sp|O64464|PSB1_ORYSJ | Proteasome subunit beta type-1 OS=Oryza sativa subsp. japonica GN=PBF1 PE=2 SV=1 | 36 | 263 | 5.0E-47 |
| sp|P34286|PSB1_CAEEL | Proteasome subunit beta type-1 OS=Caenorhabditis elegans GN=pbs-6 PE=1 SV=2 | 31 | 263 | 1.0E-43 |
| sp|Q8SRH6|PSB6_ENCCU | Probable proteasome subunit beta type-6 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE7 PE=1 SV=1 | 30 | 263 | 2.0E-37 |
| sp|Q9U794|PSB1_TRYBB | Proteasome subunit beta type-1 OS=Trypanosoma brucei brucei PE=2 SV=1 | 26 | 263 | 5.0E-36 |
| sp|Q9YER0|PSB2_AERPE | Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 | 39 | 259 | 3.0E-17 |
| sp|C7P6N4|PSB_METFA | Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 | 40 | 254 | 4.0E-17 |
| sp|Q975U8|PSB1_SULTO | Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 | 42 | 260 | 4.0E-17 |
| sp|A1RWY6|PSB1_THEPD | Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 | 39 | 221 | 2.0E-16 |
| sp|A7I841|PSB_METB6 | Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 | 39 | 254 | 2.0E-16 |
| sp|A1RX71|PSB2_THEPD | Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 | 41 | 262 | 2.0E-16 |
| sp|C5A7L1|PSB1_THEGJ | Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 | 34 | 255 | 3.0E-16 |
| sp|C9REN7|PSB_METVM | Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 | 37 | 254 | 3.0E-16 |
| sp|A2BN24|PSB1_HYPBU | Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 | 39 | 251 | 5.0E-16 |
| sp|Q58634|PSB_METJA | Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 | 39 | 254 | 6.0E-16 |
| sp|Q0W2D6|PSB_METAR | Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 | 39 | 254 | 7.0E-16 |
| sp|Q4JAY3|PSB1_SULAC | Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 | 42 | 260 | 1.0E-15 |
| sp|C3N7K2|PSB2_SULIY | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|C3MY41|PSB2_SULIM | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|C3MRE5|PSB2_SULIL | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|C4KIR0|PSB2_SULIK | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|D2PDG6|PSB2_SULID | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|C3MZI0|PSB2_SULIA | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|C3NFX2|PSB1_SULIN | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|A8AA46|PSB1_IGNH4 | Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 | 40 | 191 | 1.0E-15 |
| sp|Q980L4|PSB1_SULSO | Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|D0KRX1|PSB1_SULS9 | Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 | 42 | 259 | 1.0E-15 |
| sp|A2BN27|PSB2_HYPBU | Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 | 39 | 191 | 1.0E-15 |
| sp|Q8PZ04|PSB_METMA | Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 | 40 | 229 | 2.0E-15 |
| sp|D3S8M7|PSB_METSF | Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 | 39 | 254 | 2.0E-15 |
| sp|B8D673|PSB1_DESK1 | Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 | 41 | 261 | 2.0E-15 |
| sp|Q2NI68|PSB_METST | Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 | 40 | 254 | 3.0E-15 |
| sp|B1YDJ0|PSB2_PYRNV | Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 | 40 | 239 | 4.0E-15 |
| sp|Q46G14|PSB_METBF | Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 | 40 | 229 | 5.0E-15 |
| sp|Q2FQL8|PSB_METHJ | Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 | 37 | 255 | 6.0E-15 |
| sp|B8GG66|PSB_METPE | Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 | 37 | 255 | 7.0E-15 |
| sp|A3CUS9|PSB_METMJ | Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 | 39 | 255 | 9.0E-15 |
| sp|C6A3R1|PSB2_THESM | Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 | 39 | 262 | 1.0E-14 |
| sp|A0B5B1|PSB_METTP | Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 | 39 | 167 | 2.0E-14 |
| sp|A8AB58|PSB2_IGNH4 | Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 | 39 | 253 | 2.0E-14 |
| sp|B6YSW2|PSB1_THEON | Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 | 39 | 255 | 2.0E-14 |
| sp|A6VK02|PSB_METM7 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 | 40 | 253 | 2.0E-14 |
| sp|A9A788|PSB_METM6 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 | 40 | 253 | 2.0E-14 |
| sp|Q6LZD4|PSB_METMP | Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 | 40 | 254 | 3.0E-14 |
| sp|Q8TJB5|PSB_METAC | Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 | 40 | 229 | 3.0E-14 |
| sp|Q9P992|PSB_METTE | Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 | 40 | 229 | 4.0E-14 |
| sp|Q9YES4|PSB1_AERPE | Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 | 40 | 190 | 6.0E-14 |
| sp|Q5JHL8|PSB2_THEKO | Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 | 39 | 262 | 7.0E-14 |
| sp|C5A2D5|PSB2_THEGJ | Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 | 39 | 262 | 1.0E-13 |
| sp|C6A2V9|PSB1_THESM | Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 | 39 | 255 | 1.0E-13 |
| sp|A4WMZ0|PSB2_PYRAR | Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 | 40 | 239 | 2.0E-13 |
| sp|A4FYA5|PSB_METM5 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 | 40 | 254 | 2.0E-13 |
| sp|Q8U125|PSB2_PYRFU | Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 | 40 | 255 | 2.0E-13 |
| sp|D2RGT4|PSB_ARCPA | Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 | 39 | 252 | 2.0E-13 |
| sp|A9A4A1|PSB1_NITMS | Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 | 40 | 255 | 3.0E-13 |
| sp|Q18GX3|PSB_HALWD | Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 | 37 | 256 | 3.0E-13 |
| sp|Q8ZST5|PSB2_PYRAE | Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 | 40 | 190 | 4.0E-13 |
| sp|O50110|PSB2_PYRHO | Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 | 40 | 255 | 5.0E-13 |
| sp|A1RSJ8|PSB1_PYRIL | Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 | 40 | 189 | 5.0E-13 |
| sp|O27270|PSB_METTH | Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 | 37 | 167 | 5.0E-13 |
| sp|A3DN27|PSB2_STAMF | Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 | 42 | 179 | 7.0E-13 |
| sp|A4YJ04|PSB2_METS5 | Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 | 42 | 252 | 9.0E-13 |
| sp|Q9P996|PSB_ARCFU | Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 | 39 | 183 | 1.0E-12 |
| sp|D4GYZ1|PSB_HALVD | Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 | 37 | 254 | 1.0E-12 |
| sp|Q9V0N9|PSB2_PYRAB | Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 | 39 | 255 | 2.0E-12 |
| sp|A6USJ3|PSB_METVS | Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 | 40 | 173 | 2.0E-12 |
| sp|B8D683|PSB2_DESK1 | Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 | 42 | 262 | 2.0E-12 |
| sp|D3E0A3|PSB_METRM | Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 | 34 | 191 | 3.0E-12 |
| sp|Q9V247|PSB1_PYRAB | Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 | 39 | 260 | 4.0E-12 |
| sp|A3MXQ6|PSB2_PYRCJ | Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 | 40 | 247 | 4.0E-12 |
| sp|A9A2U7|PSB2_NITMS | Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 | 39 | 252 | 6.0E-12 |
| sp|D5EAS6|PSB_METMS | Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 | 40 | 191 | 6.0E-12 |
| sp|A0RXV1|PSB2_CENSY | Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 | 39 | 254 | 7.0E-12 |
| sp|D1Z199|PSB_METPS | Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 | 40 | 254 | 8.0E-12 |
| sp|Q8ZYF2|PSB1_PYRAE | Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 | 42 | 208 | 8.0E-12 |
| sp|Q8U4C9|PSB1_PYRFU | Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 | 39 | 258 | 8.0E-12 |
| sp|D3RX66|PSB_FERPA | Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 | 39 | 167 | 9.0E-12 |
| sp|A3MS44|PSB1_PYRCJ | Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 | 42 | 208 | 1.0E-11 |
| sp|A2SS78|PSB_METLZ | Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 | 40 | 183 | 1.0E-11 |
| sp|B1L6S7|PSB1_KORCO | Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 | 39 | 253 | 2.0E-11 |
| sp|A4WH05|PSB1_PYRAR | Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 | 42 | 208 | 2.0E-11 |
| sp|B6YXV3|PSB2_THEON | Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 | 46 | 258 | 2.0E-11 |
| sp|Q9UXF3|PSB2_SULSO | Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 | 40 | 211 | 2.0E-11 |
| sp|D0KTH0|PSB2_SULS9 | Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 | 40 | 211 | 2.0E-11 |
| sp|C3NHF1|PSB2_SULIN | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 | 40 | 211 | 2.0E-11 |
| sp|A1RTI7|PSB2_PYRIL | Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 | 42 | 208 | 2.0E-11 |
| sp|C3NE98|PSB1_SULIY | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 | 40 | 211 | 2.0E-11 |
| sp|C3MVD5|PSB1_SULIM | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 | 40 | 211 | 2.0E-11 |
| sp|C3MQ16|PSB1_SULIL | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 | 40 | 211 | 2.0E-11 |
| sp|C4KHB0|PSB1_SULIK | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 | 40 | 211 | 2.0E-11 |
| sp|D2PK63|PSB1_SULID | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 | 40 | 211 | 2.0E-11 |
| sp|C3N5N4|PSB1_SULIA | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 | 40 | 211 | 2.0E-11 |
| sp|A8M8R5|PSB2_CALMQ | Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 | 41 | 260 | 2.0E-11 |
| sp|A6UT20|PSB_META3 | Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 | 40 | 254 | 4.0E-11 |
| sp|A4YIE0|PSB1_METS5 | Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 | 40 | 190 | 4.0E-11 |
| sp|Q12YV7|PSB_METBU | Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 | 40 | 254 | 4.0E-11 |
| sp|A0RU86|PSB1_CENSY | Proteasome subunit beta 1 OS=Cenarchaeum symbiosum (strain A) GN=psmB1 PE=3 SV=1 | 40 | 191 | 4.0E-11 |
| sp|Q6L181|PSB_PICTO | Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 | 40 | 248 | 5.0E-11 |
| sp|O57983|PSB1_PYRHO | Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 | 39 | 260 | 5.0E-11 |
| sp|B1YA36|PSB1_PYRNV | Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 | 42 | 208 | 1.0E-10 |
| sp|B1L6X8|PSB2_KORCO | Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 | 52 | 261 | 2.0E-10 |
| sp|Q97AZ7|PSB_THEVO | Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 | 33 | 250 | 4.0E-10 |
| sp|Q5JDJ9|PSB1_THEKO | Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 | 39 | 255 | 7.0E-10 |
| sp|P28061|PSB_THEAC | Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 | 33 | 252 | 3.0E-09 |
| sp|Q8TW10|PSB_METKA | Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 | 39 | 181 | 3.0E-09 |
| sp|A8MBW0|PSB1_CALMQ | Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 | 53 | 208 | 4.0E-09 |
| sp|A5UM14|PSB_METS3 | Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 | 40 | 254 | 4.0E-09 |
| sp|Q4JAA8|PSB2_SULAC | Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 | 40 | 195 | 5.0E-09 |
| sp|B5IEE5|PSB_ACIB4 | Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 | 50 | 263 | 7.0E-09 |
| sp|O43063|PSB1_SCHPO | Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 | 50 | 260 | 8.0E-09 |
| sp|Q975D1|PSB2_SULTO | Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 | 39 | 181 | 1.0E-08 |
| sp|A3DN21|PSB1_STAMF | Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 | 41 | 252 | 3.0E-08 |
| sp|Q9N9W8|PSB3_GIAIN | Proteasome subunit beta type-3 OS=Giardia intestinalis GN=PRSBETA3 PE=2 SV=1 | 34 | 252 | 4.0E-08 |
| sp|Q5W416|PSB8_CANLF | Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 | 23 | 161 | 7.0E-08 |
| sp|Q9Y7T8|PSB3_SCHPO | Probable proteasome subunit beta type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup3 PE=3 SV=1 | 39 | 167 | 1.0E-07 |
| sp|P34065|PSB5_CHICK | Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 | 39 | 190 | 2.0E-07 |
| sp|O55234|PSB5_MOUSE | Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 | 24 | 233 | 3.0E-07 |
| sp|P28075|PSB5_RAT | Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 | 24 | 233 | 8.0E-07 |
| sp|Q9LST7|PSB3_ORYSJ | Proteasome subunit beta type-3 OS=Oryza sativa subsp. japonica GN=PBC1 PE=2 SV=1 | 39 | 183 | 1.0E-06 |
| sp|Q55D66|PSB3_DICDI | Proteasome subunit beta type-3 OS=Dictyostelium discoideum GN=psmB3 PE=3 SV=1 | 39 | 153 | 1.0E-06 |
| sp|O65084|PSB3_PICMA | Proteasome subunit beta type-3 OS=Picea mariana GN=PBC1 PE=2 SV=1 | 39 | 183 | 2.0E-06 |
| sp|P25451|PSB3_YEAST | Proteasome subunit beta type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP3 PE=1 SV=1 | 34 | 263 | 4.0E-06 |
| sp|Q32KL2|PSB5_BOVIN | Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 | 24 | 233 | 4.0E-06 |
| sp|Q5V1D5|PSB2_HALMA | Proteasome subunit beta 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB2 PE=3 SV=1 | 40 | 254 | 7.0E-06 |
| sp|P40112|PSB3_RAT | Proteasome subunit beta type-3 OS=Rattus norvegicus GN=Psmb3 PE=1 SV=1 | 39 | 167 | 9.0E-06 |
| sp|Q9R1P1|PSB3_MOUSE | Proteasome subunit beta type-3 OS=Mus musculus GN=Psmb3 PE=1 SV=1 | 39 | 167 | 9.0E-06 |
| sp|P33672|PSB3_BOVIN | Proteasome subunit beta type-3 OS=Bos taurus GN=PSMB3 PE=1 SV=3 | 39 | 167 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0051603 | proteolysis involved in protein catabolic process | Yes |
| GO:0005839 | proteasome core complex | Yes |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0032991 | protein-containing complex | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0006508 | proteolysis | No |
| GO:0019538 | protein metabolic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0005575 | cellular_component | No |
| GO:0008150 | biological_process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm|Nucleus | 0.7592 | 0.6426 | 0.0841 | 0.0321 | 0.0775 | 0.0006 | 0.0849 | 0.2226 | 0.102 | 0.0182 |
| Orthofinder run ID | 4 |
| Orthogroup | 1999 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|2238 MAAMFSQNPLMDGPNYSFVDTPKTAGEPREHRFNPYTDNGGSTLGIAGADFAIMAGDTRHTSGYSINSRMAPKVF RIGGSTASQEDATIVLSVCGFAADGSALRDQLDTICKIYRHRHGKPMTLNACAKRLSTILYQKRFFPYYTAAMLG GLDEEGRGAIYSYDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQCEPGSGTGHDLKERERHPLPRSRVEIIV KDAFDGAAERHIEVGDALQMMVITKDGIEETFVPLKKD* |
| Coding | >Hirsu2|2238 ATGGCCGCCATGTTTAGCCAGAACCCGTTGATGGACGGCCCGAACTACTCCTTCGTCGACACCCCGAAGACGGCG GGTGAGCCGAGGGAGCATCGCTTCAACCCCTACACCGACAACGGCGGCTCCACGCTCGGCATCGCTGGGGCCGAT TTCGCCATCATGGCCGGCGACACCCGGCACACCAGCGGTTACAGCATCAACTCCCGGATGGCGCCCAAGGTGTTC AGGATCGGCGGGTCCACGGCCTCGCAAGAAGATGCGACCATCGTGTTGTCGGTCTGCGGCTTCGCCGCCGACGGC TCCGCCCTGCGAGACCAGCTGGACACCATCTGCAAGATCTACCGCCATCGCCACGGCAAGCCCATGACGCTCAAC GCCTGCGCCAAGCGCCTGTCGACGATTCTCTACCAGAAGCGCTTCTTCCCCTACTACACCGCCGCCATGCTGGGC GGCCTCGATGAGGAGGGCAGGGGGGCCATCTACTCGTACGACCCGGTCGGCAGCTACGAACGCGAACAGTGCCGT GCTGGGGGGGCCGCCGCCAGCCTGATCATGCCCTTCCTCGACAACCAGGTCAACTTCAAGAATCAGTGCGAGCCG GGGAGCGGCACCGGGCACGACCTGAAGGAGCGCGAGCGCCATCCTCTGCCGCGGTCGCGGGTCGAGATAATTGTC AAGGATGCCTTTGACGGTGCTGCGGAGAGACACATCGAGGTTGGCGACGCTCTCCAGATGATGGTCATCACCAAG GACGGGATCGAAGAGACTTTCGTGCCGCTGAAGAAGGACTAG |
| Transcript | >Hirsu2|2238 ATGGCCGCCATGTTTAGCCAGAACCCGTTGATGGACGGCCCGAACTACTCCTTCGTCGACACCCCGAAGACGGCG GGTGAGCCGAGGGAGCATCGCTTCAACCCCTACACCGACAACGGCGGCTCCACGCTCGGCATCGCTGGGGCCGAT TTCGCCATCATGGCCGGCGACACCCGGCACACCAGCGGTTACAGCATCAACTCCCGGATGGCGCCCAAGGTGTTC AGGATCGGCGGGTCCACGGCCTCGCAAGAAGATGCGACCATCGTGTTGTCGGTCTGCGGCTTCGCCGCCGACGGC TCCGCCCTGCGAGACCAGCTGGACACCATCTGCAAGATCTACCGCCATCGCCACGGCAAGCCCATGACGCTCAAC GCCTGCGCCAAGCGCCTGTCGACGATTCTCTACCAGAAGCGCTTCTTCCCCTACTACACCGCCGCCATGCTGGGC GGCCTCGATGAGGAGGGCAGGGGGGCCATCTACTCGTACGACCCGGTCGGCAGCTACGAACGCGAACAGTGCCGT GCTGGGGGGGCCGCCGCCAGCCTGATCATGCCCTTCCTCGACAACCAGGTCAACTTCAAGAATCAGTGCGAGCCG GGGAGCGGCACCGGGCACGACCTGAAGGAGCGCGAGCGCCATCCTCTGCCGCGGTCGCGGGTCGAGATAATTGTC AAGGATGCCTTTGACGGTGCTGCGGAGAGACACATCGAGGTTGGCGACGCTCTCCAGATGATGGTCATCACCAAG GACGGGATCGAAGAGACTTTCGTGCCGCTGAAGAAGGACTAG |
| Gene | >Hirsu2|2238 ATGGCCGCCATGTTTAGCCAGAACCCGTTGATGGACGGCCCGAACTACTCCTTCGTCGACACCCCGAAGACGGCG GGTGAGCCGAGGGAGCATCGCTTCAACCCGTGCGTCTGCCGTCCGCAGCCTGCCGTGGCCCCCTTGAAACGCTGA CACATGGCCCCAGCTACACCGACAACGGCGGCTCCACGCTCGGCATCGCTGGGGCCGATTTCGCCATCATGGCCG GCGACACCCGGCACACCAGCGGTTACAGCATCAACTCCCGGATGGCGCCCAAGGTGTTCAGGATCGGCGGGTCCA CGGCCTCGCAAGAAGATGCGACCATCGTGTTGTCGGTCTGCGGCTTCGCCGCCGACGGCTCCGCCCTGCGAGACC AGCTGGACACCATCTGCAAGATCTACCGCCATCGCCACGGCAAGCCCATGACGCTCAACGCCTGCGCCAAGCGCC TGTCGACGATTCTCTACCAGAAGCGCTTCTTCCCCTACTACACCGCCGCCATGCTGGGCGGCCTCGATGAGGAGG GCAGGGGGGCCATCTACTCGTACGACCCGGTCGGCAGCTACGAACGCGAACAGTGCCGTGCTGGGGGGGCCGCCG CCAGCCTGATCATGCCCTTCCTCGACAACCAGGTCAACTTCAAGAATCAGTGCGAGCCGGGGAGCGGCACCGGGC ACGACCTGAAGGAGCGCGAGCGCCATCCTCTGCCGCGGTCGCGGGTCGAGATAATTGTCAAGGATGCCTTTGACG GTGCTGCGGAGAGACACATCGAGGTTGGCGACGCTCTCCAGATGATGGTCATCACCAAGGACGGGATCGAAGAGA CTTTCGTGCCGCTGAAGAAGGACTAG |