Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2235
Gene name
LocationContig_152:9176..10348
Strand-
Gene length (bp)1172
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08423 Rad51 Rad51 4.6E-127 85 339
PF13481 AAA_25 AAA domain 1.9E-09 103 269
PF00154 RecA recA bacterial DNA recombination protein 2.3E-08 95 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36601|RAD51_SCHPO DNA repair protein rhp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp51 PE=1 SV=1 1 340 0.0E+00
sp|Q06609|RAD51_HUMAN DNA repair protein RAD51 homolog 1 OS=Homo sapiens GN=RAD51 PE=1 SV=1 22 339 2.0E-173
sp|Q99133|RAD51_USTMA DNA repair protein RAD51 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD51 PE=3 SV=1 6 340 5.0E-173
sp|P70099|RAD51_CRIGR DNA repair protein RAD51 homolog 1 OS=Cricetulus griseus GN=RAD51 PE=2 SV=1 22 339 8.0E-173
sp|Q2KJ94|RAD51_BOVIN DNA repair protein RAD51 homolog 1 OS=Bos taurus GN=RAD51 PE=2 SV=1 22 339 1.0E-172
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36601|RAD51_SCHPO DNA repair protein rhp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp51 PE=1 SV=1 1 340 0.0E+00
sp|Q06609|RAD51_HUMAN DNA repair protein RAD51 homolog 1 OS=Homo sapiens GN=RAD51 PE=1 SV=1 22 339 2.0E-173
sp|Q99133|RAD51_USTMA DNA repair protein RAD51 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD51 PE=3 SV=1 6 340 5.0E-173
sp|P70099|RAD51_CRIGR DNA repair protein RAD51 homolog 1 OS=Cricetulus griseus GN=RAD51 PE=2 SV=1 22 339 8.0E-173
sp|Q2KJ94|RAD51_BOVIN DNA repair protein RAD51 homolog 1 OS=Bos taurus GN=RAD51 PE=2 SV=1 22 339 1.0E-172
sp|Q8MKI8|RAD51_CANLF DNA repair protein RAD51 homolog 1 OS=Canis lupus familiaris GN=RAD51 PE=2 SV=1 22 339 2.0E-172
sp|Q08297|RAD51_MOUSE DNA repair protein RAD51 homolog 1 OS=Mus musculus GN=Rad51 PE=1 SV=1 22 339 3.0E-172
sp|Q91917|RA51B_XENLA DNA repair protein RAD51 homolog B OS=Xenopus laevis GN=rad51-b PE=2 SV=1 7 339 1.0E-171
sp|P37383|RAD51_CHICK DNA repair protein RAD51 homolog 1 OS=Gallus gallus GN=RAD51A PE=2 SV=1 22 339 1.0E-171
sp|Q91918|RA51A_XENLA DNA repair protein RAD51 homolog A OS=Xenopus laevis GN=rad51-a PE=2 SV=1 7 339 2.0E-171
sp|O77507|RAD51_RABIT DNA repair protein RAD51 homolog 1 OS=Oryctolagus cuniculus GN=RAD51 PE=2 SV=1 22 339 1.0E-170
sp|P25454|RAD51_YEAST DNA repair protein RAD51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD51 PE=1 SV=1 3 344 1.0E-156
sp|Q67EU8|R51A1_MAIZE DNA repair protein RAD51 homolog A OS=Zea mays GN=RAD51A PE=2 SV=2 22 339 3.0E-152
sp|Q9XED7|R51A2_MAIZE DNA repair protein RAD51 homolog B OS=Zea mays GN=RAD51B PE=2 SV=1 22 339 5.0E-152
sp|P94102|RAD51_ARATH DNA repair protein RAD51 homolog 1 OS=Arabidopsis thaliana GN=RAD51 PE=1 SV=1 22 339 8.0E-152
sp|Q40134|RAD51_SOLLC DNA repair protein RAD51 homolog OS=Solanum lycopersicum GN=RAD51 PE=2 SV=1 22 339 1.0E-149
sp|Q27297|RAD51_DROME DNA repair protein Rad51 homolog OS=Drosophila melanogaster GN=spn-A PE=2 SV=1 24 339 6.0E-137
sp|Q61880|DMC1_MOUSE Meiotic recombination protein DMC1/LIM15 homolog OS=Mus musculus GN=Dmc1 PE=1 SV=1 33 339 4.0E-107
sp|Q14565|DMC1_HUMAN Meiotic recombination protein DMC1/LIM15 homolog OS=Homo sapiens GN=DMC1 PE=1 SV=2 33 339 1.0E-105
sp|P37384|DMC1_LILLO Meiotic recombination protein DMC1 homolog OS=Lilium longiflorum GN=LIM15 PE=2 SV=1 33 339 1.0E-104
sp|P50265|DLH1_CANAX Meiotic recombination protein DLH1 OS=Candida albicans GN=DLH1 PE=3 SV=1 33 346 2.0E-102
sp|P25453|DMC1_YEAST Meiotic recombination protein DMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMC1 PE=1 SV=1 33 341 2.0E-102
sp|Q96449|DMC1_SOYBN Meiotic recombination protein DMC1 homolog OS=Glycine max PE=2 SV=1 33 339 4.0E-101
sp|Q39009|DMC1_ARATH Meiotic recombination protein DMC1 homolog OS=Arabidopsis thaliana GN=DMC1 PE=1 SV=2 33 339 2.0E-100
sp|O42634|DMC1_SCHPO Meiotic recombination protein dmc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dmc1 PE=1 SV=2 33 339 5.0E-98
sp|A3MXX9|RADA_PYRCJ DNA repair and recombination protein RadA OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=radA PE=3 SV=1 28 339 3.0E-87
sp|Q8ZYR9|RADA_PYRAE DNA repair and recombination protein RadA OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=radA PE=3 SV=1 21 339 4.0E-86
sp|B1YC14|RADA_PYRNV DNA repair and recombination protein RadA OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=radA PE=3 SV=1 28 339 5.0E-86
sp|Q9UWR5|RADA_PYRIL DNA repair and recombination protein RadA OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=radA PE=3 SV=2 28 339 1.0E-85
sp|O29269|RADA_ARCFU DNA repair and recombination protein RadA OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=radA PE=3 SV=1 23 339 2.0E-85
sp|P0CW91|RADA_AERPX DNA repair and recombination protein RadA OS=Aeropyrum pernix GN=radA PE=3 SV=1 40 340 4.0E-85
sp|P0CW92|RADA_AERPE DNA repair and recombination protein RadA OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=radA PE=3 SV=1 40 340 7.0E-85
sp|Q9V233|RADA_PYRAB DNA repair and recombination protein RadA OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=radA PE=3 SV=2 25 339 1.0E-84
sp|O74036|RADA_PYRFU DNA repair and recombination protein RadA OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=radA PE=1 SV=1 25 339 1.0E-84
sp|A4WN87|RADA_PYRAR DNA repair and recombination protein RadA OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=radA PE=3 SV=1 28 339 2.0E-84
sp|A8AB83|RADA_IGNH4 DNA repair and recombination protein RadA OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=radA PE=3 SV=1 22 340 1.0E-80
sp|Q9Y8J4|RADA_DESAM DNA repair and recombination protein RadA OS=Desulfurococcus amylolyticus GN=radA PE=3 SV=1 45 339 6.0E-79
sp|C3N7M8|RADA_SULIY DNA repair and recombination protein RadA OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=radA PE=3 SV=1 25 339 7.0E-79
sp|C3NFU5|RADA_SULIN DNA repair and recombination protein RadA OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=radA PE=3 SV=1 25 339 7.0E-79
sp|C3MY77|RADA_SULIM DNA repair and recombination protein RadA OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=radA PE=3 SV=1 25 339 7.0E-79
sp|C3MRI1|RADA_SULIL DNA repair and recombination protein RadA OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=radA PE=3 SV=1 25 339 7.0E-79
sp|C4KIT6|RADA_SULIK DNA repair and recombination protein RadA OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=radA PE=3 SV=1 25 339 7.0E-79
sp|C3MZK6|RADA_SULIA DNA repair and recombination protein RadA OS=Sulfolobus islandicus (strain M.16.27) GN=radA PE=3 SV=1 25 339 7.0E-79
sp|Q4JAT5|RADA_SULAC DNA repair and recombination protein RadA OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=radA PE=3 SV=1 25 339 7.0E-79
sp|Q55075|RADA_SULSO DNA repair and recombination protein RadA OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=radA PE=1 SV=2 25 339 7.0E-79
sp|Q975Y1|RADA_SULTO DNA repair and recombination protein RadA OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=radA PE=3 SV=1 25 339 1.0E-78
sp|B8D610|RADA_DESK1 DNA repair and recombination protein RadA OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=radA PE=3 SV=1 45 339 5.0E-78
sp|A4YCN4|RADA_METS5 DNA repair and recombination protein RadA OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=radA PE=3 SV=1 25 339 1.0E-77
sp|O93748|RADA_CENSY DNA repair and recombination protein RadA OS=Cenarchaeum symbiosum (strain A) GN=radA PE=3 SV=2 25 339 2.0E-76
sp|Q6L126|RADA_PICTO DNA repair and recombination protein RadA OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=radA PE=3 SV=1 28 339 2.0E-76
sp|Q2NE95|RADA_METST DNA repair and recombination protein RadA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=radA PE=3 SV=1 25 339 4.0E-76
sp|Q97BJ9|RADA_THEVO DNA repair and recombination protein RadA OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=radA PE=3 SV=1 26 339 4.0E-76
sp|Q9HJ68|RADA_THEAC DNA repair and recombination protein RadA OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=radA PE=3 SV=1 28 339 1.0E-75
sp|Q74MX9|RADA_NANEQ DNA repair and recombination protein RadA OS=Nanoarchaeum equitans (strain Kin4-M) GN=radA PE=3 SV=1 22 340 2.0E-75
sp|O27436|RADA_METTH DNA repair and recombination protein RadA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=radA PE=3 SV=1 28 339 1.0E-74
sp|Q49593|RADA_METJA DNA repair and recombination protein RadA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=radA PE=3 SV=1 25 339 6.0E-73
sp|A5UMW0|RADA_METS3 DNA repair and recombination protein RadA OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=radA PE=3 SV=1 28 339 3.0E-72
sp|Q8TK71|RADA_METAC DNA repair and recombination protein RadA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=radA PE=3 SV=1 27 339 2.0E-71
sp|Q8PZN5|RADA_METMA DNA repair and recombination protein RadA OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=radA PE=3 SV=2 27 339 2.0E-71
sp|A2SR54|RADA_METLZ DNA repair and recombination protein RadA OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=radA PE=3 SV=1 28 337 2.0E-70
sp|Q12UG7|RADA_METBU DNA repair and recombination protein RadA OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=radA PE=3 SV=1 40 339 3.0E-70
sp|O73948|RADA_METVO DNA repair and recombination protein RadA OS=Methanococcus voltae GN=radA PE=1 SV=1 42 339 2.0E-69
sp|Q46A31|RADA_METBF DNA repair and recombination protein RadA OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=radA PE=3 SV=1 28 339 3.0E-69
sp|A4FWV5|RADA_METM5 DNA repair and recombination protein RadA OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=radA PE=3 SV=1 42 339 6.0E-66
sp|A9AA90|RADA_METM6 DNA repair and recombination protein RadA OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=radA PE=3 SV=1 42 339 1.0E-65
sp|P0CW59|RADA_METMP DNA repair and recombination protein RadA OS=Methanococcus maripaludis (strain S2 / LL) GN=radA PE=3 SV=1 42 339 1.0E-65
sp|A6VGG2|RADA_METM7 DNA repair and recombination protein RadA OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=radA PE=3 SV=1 42 339 5.0E-65
sp|P0CW58|RADA_METMI DNA repair and recombination protein RadA OS=Methanococcus maripaludis GN=radA PE=1 SV=1 42 339 2.0E-64
sp|A3CWU4|RADA_METMJ DNA repair and recombination protein RadA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=radA PE=3 SV=1 28 337 2.0E-61
sp|Q9HMM4|RADA_HALSA DNA repair and recombination protein RadA OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=radA PE=3 SV=2 24 337 2.0E-60
sp|B0R7Y4|RADA_HALS3 DNA repair and recombination protein RadA OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=radA PE=3 SV=1 24 337 2.0E-60
sp|Q48328|RADA_HALVD DNA repair and recombination protein RadA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=radA PE=3 SV=1 28 337 1.0E-58
sp|Q18EU1|RADA_HALWD DNA repair and recombination protein RadA OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=radA PE=3 SV=1 24 337 1.0E-57
sp|O58001|RADA_PYRHO DNA repair and recombination protein RadA OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=radA PE=1 SV=1 135 339 2.0E-54
sp|Q5JET4|RADA_THEKO DNA repair and recombination protein RadA OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=radA PE=3 SV=1 135 339 1.0E-52
sp|C6A0N1|RADB_THESM DNA repair and recombination protein RadB OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=radB PE=3 SV=1 103 339 8.0E-27
sp|O15315|RA51B_HUMAN DNA repair protein RAD51 homolog 2 OS=Homo sapiens GN=RAD51B PE=1 SV=2 61 337 2.0E-26
sp|O35719|RA51B_MOUSE DNA repair protein RAD51 homolog 2 OS=Mus musculus GN=Rad51b PE=2 SV=2 61 337 2.0E-25
sp|Q8GXF0|RA51C_ARATH DNA repair protein RAD51 homolog 3 OS=Arabidopsis thaliana GN=RAD51C PE=1 SV=2 66 317 7.0E-25
sp|Q9V2F6|RADB_PYRAB DNA repair and recombination protein RadB OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=radB PE=3 SV=2 101 339 6.0E-24
sp|Q12U80|RADB_METBU DNA repair and recombination protein RadB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=radB PE=3 SV=1 108 337 5.0E-23
sp|Q54PJ7|RA51C_DICDI DNA repair protein RAD51 homolog 3 OS=Dictyostelium discoideum GN=rad51c PE=3 SV=1 102 339 1.0E-22
sp|P81415|RADB_PYRFU DNA repair and recombination protein RadB OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=radB PE=1 SV=1 103 344 1.0E-22
sp|O57859|RADB_PYRHO DNA repair and recombination protein RadB OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=radB PE=3 SV=1 103 339 8.0E-22
sp|Q8R2J9|RA51C_CRIGR DNA repair protein RAD51 homolog 3 OS=Cricetulus griseus GN=RAD51C PE=2 SV=1 42 341 3.0E-21
sp|Q9FKM5|XRCC3_ARATH DNA repair protein XRCC3 homolog OS=Arabidopsis thaliana GN=XRCC3 PE=1 SV=1 103 337 4.0E-20
sp|O28184|RADB_ARCFU DNA repair and recombination protein RadB OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=radB PE=3 SV=1 103 337 1.0E-19
sp|B6YXT4|RADB_THEON DNA repair and recombination protein RadB OS=Thermococcus onnurineus (strain NA1) GN=radB PE=3 SV=1 103 339 1.0E-19
sp|O43502|RA51C_HUMAN DNA repair protein RAD51 homolog 3 OS=Homo sapiens GN=RAD51C PE=1 SV=1 42 339 3.0E-19
sp|Q9HPF2|RADB_HALSA DNA repair and recombination protein RadB OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=radB PE=3 SV=1 97 344 5.0E-19
sp|B0R636|RADB_HALS3 DNA repair and recombination protein RadB OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=radB PE=3 SV=1 97 344 5.0E-19
sp|Q924H5|RA51C_MOUSE DNA repair protein RAD51 homolog 3 OS=Mus musculus GN=Rad51c PE=2 SV=1 42 339 7.0E-19
sp|Q2NHD1|RADB_METST DNA repair and recombination protein RadB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=radB PE=3 SV=1 98 307 6.0E-18
sp|Q9SK02|RA51B_ARATH DNA repair protein RAD51 homolog 2 OS=Arabidopsis thaliana GN=RAD51B PE=2 SV=2 103 337 1.0E-17
sp|A3CXI2|RADB_METMJ DNA repair and recombination protein RadB OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=radB PE=3 SV=1 103 337 2.0E-17
sp|A5UKT8|RADB_METS3 DNA repair and recombination protein RadB OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=radB PE=3 SV=1 110 337 3.0E-17
sp|Q9UUL2|RAD57_SCHPO DNA repair protein rhp57 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp57 PE=1 SV=1 103 337 3.0E-17
sp|Q9HJD3|RADB_THEAC DNA repair and recombination protein RadB OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=radB PE=3 SV=2 103 337 1.0E-16
sp|P95547|RADB_THEKO DNA repair and recombination protein RadB OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=radB PE=1 SV=2 103 270 2.0E-16
sp|O43542|XRCC3_HUMAN DNA repair protein XRCC3 OS=Homo sapiens GN=XRCC3 PE=1 SV=1 34 340 6.0E-16
sp|Q5JET4|RADA_THEKO DNA repair and recombination protein RadA OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=radA PE=3 SV=1 25 134 8.0E-16
sp|P25301|RAD57_YEAST DNA repair protein RAD57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD57 PE=1 SV=1 103 270 1.0E-15
sp|Q57702|RADB_METJA DNA repair and recombination protein RadB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=radB PE=3 SV=1 110 337 8.0E-15
sp|O58001|RADA_PYRHO DNA repair and recombination protein RadA OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=radA PE=1 SV=1 44 134 2.0E-14
sp|Q08DH8|XRCC3_BOVIN DNA repair protein XRCC3 OS=Bos taurus GN=XRCC3 PE=2 SV=1 92 337 1.0E-12
sp|Q9CX47|XRCC2_MOUSE DNA repair protein XRCC2 OS=Mus musculus GN=Xrcc2 PE=2 SV=1 121 294 1.0E-11
sp|O43543|XRCC2_HUMAN DNA repair protein XRCC2 OS=Homo sapiens GN=XRCC2 PE=1 SV=1 121 273 4.0E-11
sp|C5A2F7|RADB_THEGJ DNA repair and recombination protein RadB OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=radB PE=3 SV=1 103 270 5.0E-11
sp|Q9CXE6|XRCC3_MOUSE DNA repair protein XRCC3 OS=Mus musculus GN=Xrcc3 PE=2 SV=1 92 337 1.0E-10
sp|Q9LQQ2|RA51D_ARATH DNA repair protein RAD51 homolog 4 OS=Arabidopsis thaliana GN=RAD51D PE=2 SV=2 86 307 1.0E-10
sp|O55230|RA51D_MOUSE DNA repair protein RAD51 homolog 4 OS=Mus musculus GN=Rad51d PE=1 SV=1 33 326 3.0E-10
sp|A6VJS2|RADB_METM7 DNA repair and recombination protein RadB OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=radB PE=3 SV=1 110 308 1.0E-09
sp|Q97B99|RADB_THEVO DNA repair and recombination protein RadB OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=radB PE=3 SV=1 106 337 1.0E-09
sp|O27728|RADB_METTH DNA repair and recombination protein RadB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=radB PE=3 SV=1 109 337 2.0E-09
sp|P96955|RECA_NEIPO Protein RecA (Fragment) OS=Neisseria polysaccharea GN=recA PE=3 SV=2 95 336 1.0E-08
sp|P97195|RECA_NEILA Protein RecA (Fragment) OS=Neisseria lactamica GN=recA PE=3 SV=2 95 336 1.0E-08
sp|E6MXY4|RECA_NEIMH Protein RecA OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) GN=recA PE=3 SV=1 95 336 2.0E-08
sp|A1KUQ0|RECA_NEIMF Protein RecA OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=recA PE=3 SV=1 95 336 2.0E-08
sp|P56987|RECA_NEIMA Protein RecA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=recA PE=3 SV=1 95 336 2.0E-08
sp|P0DH59|RECA_NEIMB Protein RecA OS=Neisseria meningitidis serogroup B (strain MC58) GN=recA PE=3 SV=1 95 336 2.0E-08
sp|P21152|RECA_NEIGO Protein RecA OS=Neisseria gonorrhoeae GN=recA PE=3 SV=2 95 336 2.0E-08
sp|B4RLX8|RECA_NEIG2 Protein RecA OS=Neisseria gonorrhoeae (strain NCCP11945) GN=recA PE=3 SV=1 95 336 2.0E-08
sp|Q5F8M9|RECA_NEIG1 Protein RecA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=recA PE=3 SV=1 95 336 2.0E-08
sp|Q59595|RECA_NEICI Protein RecA (Fragment) OS=Neisseria cinerea GN=recA PE=3 SV=1 95 331 3.0E-08
sp|P74737|RECA_SYNY3 Protein RecA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recA PE=2 SV=1 95 330 3.0E-08
sp|Q2HJ51|RA51D_BOVIN DNA repair protein RAD51 homolog 4 OS=Bos taurus GN=RAD51D PE=2 SV=1 33 324 2.0E-07
sp|A4TQ50|RECA_YERPP Protein RecA OS=Yersinia pestis (strain Pestoides F) GN=recA PE=3 SV=1 96 340 2.0E-07
sp|Q75JL2|RECAM_DICDI Mitochondrial DNA repair protein recA homolog OS=Dictyostelium discoideum GN=recA PE=3 SV=1 103 307 3.0E-07
sp|Q59597|RECA_NEIFL Protein RecA (Fragment) OS=Neisseria flavescens GN=recA PE=3 SV=1 95 307 3.0E-07
sp|Q66E70|RECA_YERPS Protein RecA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=recA PE=3 SV=1 96 340 3.0E-07
sp|B2K5X7|RECA_YERPB Protein RecA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=recA PE=3 SV=1 96 340 3.0E-07
sp|A7FLR9|RECA_YERP3 Protein RecA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=recA PE=3 SV=1 96 340 3.0E-07
sp|B1JJA2|RECA_YERPY Protein RecA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=recA PE=3 SV=1 96 340 3.0E-07
sp|Q1CLL1|RECA_YERPN Protein RecA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=recA PE=3 SV=1 96 340 3.0E-07
sp|A9R0V9|RECA_YERPG Protein RecA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=recA PE=3 SV=1 96 340 3.0E-07
sp|P37858|RECA_YERPE Protein RecA OS=Yersinia pestis GN=recA PE=3 SV=4 96 340 3.0E-07
sp|Q1C422|RECA_YERPA Protein RecA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=recA PE=3 SV=1 96 340 3.0E-07
sp|Q59629|RECA_NEIPH Protein RecA (Fragment) OS=Neisseria pharyngis GN=recA PE=3 SV=1 95 307 3.0E-07
sp|O86382|RECA_NEIEG Protein RecA (Fragment) OS=Neisseria elongata subsp. glycolytica GN=recA PE=3 SV=1 104 308 4.0E-07
sp|P47581|RECA_MYCGE Protein RecA OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=recA PE=3 SV=1 78 307 4.0E-07
sp|A4WDQ8|RECA_ENT38 Protein RecA OS=Enterobacter sp. (strain 638) GN=recA PE=3 SV=1 94 340 4.0E-07
sp|Q9ZFF6|RECA_SHISO Protein RecA OS=Shigella sonnei GN=recA PE=3 SV=3 96 340 4.0E-07
sp|Q59619|RECA_NEIMU Protein RecA (Fragment) OS=Neisseria mucosa GN=recA PE=3 SV=1 95 307 4.0E-07
sp|Q9XBC1|RECA_RHOPA Protein RecA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=recA PE=3 SV=3 94 307 5.0E-07
sp|Q1LTQ3|RECA_BAUCH Protein RecA OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=recA PE=3 SV=1 69 340 8.0E-07
sp|Q59592|RECA_NEIAN Protein RecA (Fragment) OS=Neisseria animalis GN=recA PE=3 SV=1 95 307 8.0E-07
sp|P33037|RECA_ENTAG Protein RecA OS=Enterobacter agglomerans GN=recA PE=3 SV=3 96 340 1.0E-06
sp|A1JK01|RECA_YERE8 Protein RecA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=recA PE=3 SV=1 96 340 1.0E-06
sp|Q7NXL9|RECA_CHRVO Protein RecA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=recA PE=3 SV=1 94 307 1.0E-06
sp|C4K841|RECA_HAMD5 Protein RecA OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=recA PE=3 SV=1 96 340 1.0E-06
sp|B1KPS6|RECA_SHEWM Protein RecA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=recA PE=3 SV=1 94 332 1.0E-06
sp|B7JZS9|RECA_CYAP8 Protein RecA OS=Cyanothece sp. (strain PCC 8801) GN=recA PE=3 SV=1 97 330 2.0E-06
sp|P17479|RECA_SERMA Protein RecA OS=Serratia marcescens GN=recA PE=3 SV=3 96 340 2.0E-06
sp|Q65QB0|RECA_MANSM Protein RecA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=recA PE=3 SV=1 102 340 2.0E-06
sp|Q6D1S8|RECA_PECAS Protein RecA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=recA PE=3 SV=1 96 332 2.0E-06
sp|C4K1F5|RECA_RICPU Protein RecA OS=Rickettsia peacockii (strain Rustic) GN=recA PE=3 SV=1 102 307 2.0E-06
sp|Q1RKB6|RECA_RICBR Protein RecA OS=Rickettsia bellii (strain RML369-C) GN=recA PE=3 SV=1 102 307 2.0E-06
sp|C6DCR1|RECA_PECCP Protein RecA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=recA PE=3 SV=1 96 332 2.0E-06
sp|P45383|RECA_VIBCH Protein RecA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=recA PE=3 SV=1 96 307 3.0E-06
sp|B5FAD0|RECA_VIBFM Protein RecA OS=Vibrio fischeri (strain MJ11) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q5E7G6|RECA_VIBF1 Protein RecA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|A5F9B5|RECA_VIBC3 Protein RecA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=recA PE=3 SV=1 96 307 3.0E-06
sp|B2VHD6|RECA_ERWT9 Protein RecA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=recA PE=3 SV=1 96 332 3.0E-06
sp|P96185|RECA_XENBV Protein RecA OS=Xenorhabdus bovienii GN=recA PE=3 SV=2 94 332 3.0E-06
sp|P65977|RECA_SALTY Protein RecA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=recA PE=1 SV=2 96 340 3.0E-06
sp|P65978|RECA_SALTI Protein RecA OS=Salmonella typhi GN=recA PE=3 SV=2 96 340 3.0E-06
sp|B4TT06|RECA_SALSV Protein RecA OS=Salmonella schwarzengrund (strain CVM19633) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B5BEN7|RECA_SALPK Protein RecA OS=Salmonella paratyphi A (strain AKU_12601) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|C0PWM2|RECA_SALPC Protein RecA OS=Salmonella paratyphi C (strain RKS4594) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|A9N0C5|RECA_SALPB Protein RecA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q5PF15|RECA_SALPA Protein RecA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=recA PE=3 SV=3 96 340 3.0E-06
sp|B4T3A0|RECA_SALNS Protein RecA OS=Salmonella newport (strain SL254) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B4TF13|RECA_SALHS Protein RecA OS=Salmonella heidelberg (strain SL476) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B5RDF4|RECA_SALG2 Protein RecA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B5QV78|RECA_SALEP Protein RecA OS=Salmonella enteritidis PT4 (strain P125109) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B5FSY0|RECA_SALDC Protein RecA OS=Salmonella dublin (strain CT_02021853) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q57KU4|RECA_SALCH Protein RecA OS=Salmonella choleraesuis (strain SC-B67) GN=recA PE=3 SV=3 96 340 3.0E-06
sp|B5F352|RECA_SALA4 Protein RecA OS=Salmonella agona (strain SL483) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q3YYG4|RECA_SHISS Protein RecA OS=Shigella sonnei (strain Ss046) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|P0A7G9|RECA_SHIFL Protein RecA OS=Shigella flexneri GN=recA PE=3 SV=2 96 340 3.0E-06
sp|Q0T1C5|RECA_SHIF8 Protein RecA OS=Shigella flexneri serotype 5b (strain 8401) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q32CM9|RECA_SHIDS Protein RecA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q31X64|RECA_SHIBS Protein RecA OS=Shigella boydii serotype 4 (strain Sb227) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B2U047|RECA_SHIB3 Protein RecA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B7LW30|RECA_ESCF3 Protein RecA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q1R801|RECA_ECOUT Protein RecA OS=Escherichia coli (strain UTI89 / UPEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B1LQ17|RECA_ECOSM Protein RecA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B6I685|RECA_ECOSE Protein RecA OS=Escherichia coli (strain SE11) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B7N6S9|RECA_ECOLU Protein RecA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|P0A7G6|RECA_ECOLI Protein RecA OS=Escherichia coli (strain K12) GN=recA PE=1 SV=2 96 340 3.0E-06
sp|B1IUY0|RECA_ECOLC Protein RecA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|P0A7G7|RECA_ECOL6 Protein RecA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=recA PE=3 SV=2 96 340 3.0E-06
sp|Q0TEI1|RECA_ECOL5 Protein RecA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|A8A3H6|RECA_ECOHS Protein RecA OS=Escherichia coli O9:H4 (strain HS) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|C4ZYU4|RECA_ECOBW Protein RecA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B7M9D6|RECA_ECO8A Protein RecA OS=Escherichia coli O8 (strain IAI1) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B7MYJ9|RECA_ECO81 Protein RecA OS=Escherichia coli O81 (strain ED1a) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B7NSH9|RECA_ECO7I Protein RecA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B5Z2B0|RECA_ECO5E Protein RecA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|P0A7G8|RECA_ECO57 Protein RecA OS=Escherichia coli O157:H7 GN=recA PE=3 SV=2 96 340 3.0E-06
sp|B7LEB1|RECA_ECO55 Protein RecA OS=Escherichia coli (strain 55989 / EAEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B7MKG8|RECA_ECO45 Protein RecA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|B7UHB7|RECA_ECO27 Protein RecA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|A7ZQC8|RECA_ECO24 Protein RecA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|A8FST8|RECA_SHESH Protein RecA OS=Shewanella sediminis (strain HAW-EB3) GN=recA PE=3 SV=1 94 332 3.0E-06
sp|P95526|RECA_PASMU Protein RecA OS=Pasteurella multocida (strain Pm70) GN=recA PE=3 SV=1 102 332 3.0E-06
sp|O86411|RECA_NEISI Protein RecA (Fragment) OS=Neisseria sicca GN=recA PE=3 SV=1 104 307 3.0E-06
sp|B5XVB6|RECA_KLEP3 Protein RecA OS=Klebsiella pneumoniae (strain 342) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|Q2RQH9|RECA_RHORT Protein RecA OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=recA PE=3 SV=1 85 307 3.0E-06
sp|C1D4J2|RECA_LARHH Protein RecA OS=Laribacter hongkongensis (strain HLHK9) GN=recA PE=3 SV=1 95 307 3.0E-06
sp|A8ANQ3|RECA_CITK8 Protein RecA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=recA PE=3 SV=1 96 340 3.0E-06
sp|C3PLP0|RECA_RICAE Protein RecA OS=Rickettsia africae (strain ESF-5) GN=recA PE=3 SV=1 102 307 3.0E-06
sp|P26346|RECA_PROVU Protein RecA OS=Proteus vulgaris GN=recA PE=3 SV=1 96 340 4.0E-06
sp|Q92GE1|RECA_RICCN Protein RecA OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=recA PE=3 SV=2 102 307 4.0E-06
sp|A6TCW1|RECA_KLEP7 Protein RecA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=recA PE=3 SV=1 96 340 4.0E-06
sp|A8GY17|RECA_RICB8 Protein RecA OS=Rickettsia bellii (strain OSU 85-389) GN=recA PE=3 SV=1 102 307 4.0E-06
sp|O86414|RECA_NEISU Protein RecA (Fragment) OS=Neisseria subflava GN=recA PE=3 SV=1 104 307 4.0E-06
sp|O86403|RECA_NEIPE Protein RecA (Fragment) OS=Neisseria perflava GN=recA PE=3 SV=1 104 307 4.0E-06
sp|B8J369|RECA_DESDA Protein RecA OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=recA PE=3 SV=1 103 307 4.0E-06
sp|A1RHG3|RECA_SHESW Protein RecA OS=Shewanella sp. (strain W3-18-1) GN=recA PE=3 SV=1 96 332 4.0E-06
sp|A4Y933|RECA_SHEPC Protein RecA OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=recA PE=3 SV=1 96 332 4.0E-06
sp|A9KYG0|RECA_SHEB9 Protein RecA OS=Shewanella baltica (strain OS195) GN=recA PE=3 SV=1 96 332 4.0E-06
sp|P42438|RECA_ACIAD Protein RecA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=recA PE=3 SV=1 102 332 4.0E-06
sp|Q12PY2|RECA_SHEDO Protein RecA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=recA PE=3 SV=1 96 340 4.0E-06
sp|A6WR18|RECA_SHEB8 Protein RecA OS=Shewanella baltica (strain OS185) GN=recA PE=3 SV=1 96 332 4.0E-06
sp|A3D785|RECA_SHEB5 Protein RecA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=recA PE=3 SV=1 96 332 4.0E-06
sp|B8E8U2|RECA_SHEB2 Protein RecA OS=Shewanella baltica (strain OS223) GN=recA PE=3 SV=1 96 332 4.0E-06
sp|A1S4E7|RECA_SHEAM Protein RecA OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=recA PE=3 SV=1 96 307 4.0E-06
sp|Q7M8Q1|RECA_WOLSU Protein RecA OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=recA PE=3 SV=1 102 307 4.0E-06
sp|Q7N7A6|RECA_PHOLL Protein RecA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=recA PE=3 SV=1 96 332 5.0E-06
sp|Q21L79|RECA_SACD2 Protein RecA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=recA PE=3 SV=1 73 340 5.0E-06
sp|Q9ZIQ0|RECA_BLAVI Protein RecA OS=Blastochloris viridis GN=recA PE=3 SV=1 73 307 5.0E-06
sp|Q0HXG0|RECA_SHESR Protein RecA OS=Shewanella sp. (strain MR-7) GN=recA PE=3 SV=1 96 332 5.0E-06
sp|Q0HL62|RECA_SHESM Protein RecA OS=Shewanella sp. (strain MR-4) GN=recA PE=3 SV=1 96 332 5.0E-06
sp|A8F2Q0|RECA_RICM5 Protein RecA OS=Rickettsia massiliae (strain Mtu5) GN=recA PE=3 SV=1 102 307 5.0E-06
sp|Q8EBS0|RECA_SHEON Protein RecA OS=Shewanella oneidensis (strain MR-1) GN=recA PE=3 SV=1 96 332 6.0E-06
sp|A7I456|RECA_CAMHC Protein RecA OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=recA PE=3 SV=1 74 307 6.0E-06
sp|Q4UK63|RECA_RICFE Protein RecA OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=recA PE=3 SV=1 102 307 6.0E-06
sp|Q68VY8|RECA_RICTY Protein RecA OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=recA PE=3 SV=1 102 307 6.0E-06
sp|A3QC87|RECA_SHELP Protein RecA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=recA PE=3 SV=1 94 332 6.0E-06
sp|P41079|RECA_RICPR Protein RecA OS=Rickettsia prowazekii (strain Madrid E) GN=recA PE=3 SV=1 102 307 7.0E-06
sp|A0KU92|RECA_SHESA Protein RecA OS=Shewanella sp. (strain ANA-3) GN=recA PE=3 SV=1 96 332 7.0E-06
sp|B0UGP0|RECA_METS4 Protein RecA OS=Methylobacterium sp. (strain 4-46) GN=recA PE=3 SV=1 99 307 8.0E-06
sp|B6IS93|RECA_RHOCS Protein RecA OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=recA PE=3 SV=1 98 307 8.0E-06
sp|B0V6E0|RECA_ACIBY Protein RecA OS=Acinetobacter baumannii (strain AYE) GN=recA PE=3 SV=1 102 332 8.0E-06
sp|A3M645|RECA_ACIBT Protein RecA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=recA PE=3 SV=2 102 332 8.0E-06
sp|B0VMV7|RECA_ACIBS Protein RecA OS=Acinetobacter baumannii (strain SDF) GN=recA PE=3 SV=1 102 332 8.0E-06
sp|B2I316|RECA_ACIBC Protein RecA OS=Acinetobacter baumannii (strain ACICU) GN=recA PE=3 SV=1 102 332 8.0E-06
sp|B7I9U0|RECA_ACIB5 Protein RecA OS=Acinetobacter baumannii (strain AB0057) GN=recA PE=3 SV=1 102 332 8.0E-06
sp|B7H1V4|RECA_ACIB3 Protein RecA OS=Acinetobacter baumannii (strain AB307-0294) GN=recA PE=3 SV=1 102 332 8.0E-06
sp|Q7MHR4|RECA_VIBVY Protein RecA OS=Vibrio vulnificus (strain YJ016) GN=recA PE=3 SV=2 96 307 9.0E-06
sp|Q8DC51|RECA_VIBVU Protein RecA OS=Vibrio vulnificus (strain CMCP6) GN=recA PE=3 SV=1 96 307 9.0E-06
sp|B8IP29|RECA_METNO Protein RecA OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=recA PE=3 SV=1 99 307 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003697 single-stranded DNA binding Yes
GO:0005524 ATP binding Yes
GO:0006281 DNA repair Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0006950 response to stress No
GO:0006259 DNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0050896 response to stimulus No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0003677 DNA binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0051716 cellular response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0044237 cellular metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2235
MSEDYDEAQAGEDGSLTGPGAPTPLSALEGIAGLTKRDIQLVVDGGFNTVESVAYTPRRMLEQIKGISEQKATKI
LHEASKLVPMGFTTATEMHQRRSELISITTGSKNLDTLLAGGIETGSVTELFGEFRTGKSQICHTLAVTCQLPFD
MGGGEGKCLYIDTEGTFRPVRLLAVANRFGLSGEEVLDNVAYARAYNSDHQLQLLNQAAAMMCETRFSLLVVDSA
TALYRTDFCGRGELSNRQTHLAKFMRTLQRLADEFGIAVVITNQVVAQVDGGPSAMFNPDPKKPIGGNIIAHAST
TRISLKKGRGETRVAKIYDSPCLPESDTLFAISEDGIGDPAPKDTDKD*
Coding >Hirsu2|2235
ATGAGCGAAGACTACGACGAGGCCCAGGCGGGCGAAGATGGCAGCCTGACGGGGCCCGGCGCGCCGACGCCGCTC
TCGGCGCTCGAGGGAATCGCAGGCTTGACGAAGCGCGACATTCAGCTTGTCGTGGACGGGGGGTTCAACACCGTC
GAGTCCGTCGCCTACACCCCGCGACGCATGCTGGAGCAGATCAAGGGCATCTCGGAGCAGAAGGCGACCAAGATC
TTACACGAGGCCTCCAAGCTGGTCCCCATGGGCTTCACGACGGCGACCGAAATGCACCAGAGGCGAAGCGAGCTC
ATCTCCATCACCACCGGGTCCAAGAACCTAGACACCCTACTGGCCGGCGGCATCGAGACCGGCTCCGTCACCGAG
CTCTTCGGCGAGTTCCGGACGGGTAAGAGCCAGATATGCCACACGCTCGCCGTCACGTGCCAGCTGCCCTTCGAC
ATGGGCGGCGGCGAGGGCAAGTGCCTGTACATCGACACGGAGGGCACCTTTCGCCCCGTCAGGCTCCTGGCCGTC
GCCAACCGCTTCGGCCTCTCGGGCGAGGAGGTGCTCGACAACGTGGCCTACGCGCGCGCCTACAACTCGGACCAC
CAGCTGCAGCTCCTCAACCAGGCCGCCGCCATGATGTGCGAGACGCGCTTCTCCCTGCTCGTTGTGGACAGCGCC
ACCGCCCTCTACCGCACCGACTTCTGCGGCCGCGGCGAGCTGTCCAACCGGCAGACGCACCTGGCCAAGTTCATG
CGCACCCTGCAGCGGCTCGCGGACGAGTTCGGCATCGCCGTCGTCATCACGAACCAGGTCGTGGCCCAGGTCGAC
GGCGGGCCGAGCGCCATGTTCAACCCGGATCCGAAGAAGCCCATTGGCGGCAATATCATTGCCCACGCCAGTACT
ACGAGGATCAGCCTGAAGAAGGGGCGCGGCGAGACGCGTGTGGCCAAGATCTACGACAGCCCGTGCCTGCCGGAG
AGCGACACGCTCTTTGCCATCAGCGAGGACGGCATCGGCGATCCGGCTCCCAAGGACACGGACAAGGACTGA
Transcript >Hirsu2|2235
ATGAGCGAAGACTACGACGAGGCCCAGGCGGGCGAAGATGGCAGCCTGACGGGGCCCGGCGCGCCGACGCCGCTC
TCGGCGCTCGAGGGAATCGCAGGCTTGACGAAGCGCGACATTCAGCTTGTCGTGGACGGGGGGTTCAACACCGTC
GAGTCCGTCGCCTACACCCCGCGACGCATGCTGGAGCAGATCAAGGGCATCTCGGAGCAGAAGGCGACCAAGATC
TTACACGAGGCCTCCAAGCTGGTCCCCATGGGCTTCACGACGGCGACCGAAATGCACCAGAGGCGAAGCGAGCTC
ATCTCCATCACCACCGGGTCCAAGAACCTAGACACCCTACTGGCCGGCGGCATCGAGACCGGCTCCGTCACCGAG
CTCTTCGGCGAGTTCCGGACGGGTAAGAGCCAGATATGCCACACGCTCGCCGTCACGTGCCAGCTGCCCTTCGAC
ATGGGCGGCGGCGAGGGCAAGTGCCTGTACATCGACACGGAGGGCACCTTTCGCCCCGTCAGGCTCCTGGCCGTC
GCCAACCGCTTCGGCCTCTCGGGCGAGGAGGTGCTCGACAACGTGGCCTACGCGCGCGCCTACAACTCGGACCAC
CAGCTGCAGCTCCTCAACCAGGCCGCCGCCATGATGTGCGAGACGCGCTTCTCCCTGCTCGTTGTGGACAGCGCC
ACCGCCCTCTACCGCACCGACTTCTGCGGCCGCGGCGAGCTGTCCAACCGGCAGACGCACCTGGCCAAGTTCATG
CGCACCCTGCAGCGGCTCGCGGACGAGTTCGGCATCGCCGTCGTCATCACGAACCAGGTCGTGGCCCAGGTCGAC
GGCGGGCCGAGCGCCATGTTCAACCCGGATCCGAAGAAGCCCATTGGCGGCAATATCATTGCCCACGCCAGTACT
ACGAGGATCAGCCTGAAGAAGGGGCGCGGCGAGACGCGTGTGGCCAAGATCTACGACAGCCCGTGCCTGCCGGAG
AGCGACACGCTCTTTGCCATCAGCGAGGACGGCATCGGCGATCCGGCTCCCAAGGACACGGACAAGGACTGA
Gene >Hirsu2|2235
ATGAGCGAAGACTACGACGAGGCCCAGGCGGGCGAAGATGGCAGCCTGACGGGGCCCGGCGCGCCGACGCCGCTC
TCGGCGCTCGAGGTGGGAGAGCGGCAGGTCCAAGGGGCCAAGGGCGCCATCGGCTGACGAAGTTCGCCCGCGCAG
GGAATCGCAGGCTTGACGAAGCGCGACATTCAGCTTGTCGTGGACGGGGGGTTCAACACCGTCGAGTCCGTCGCC
TACACCCCGCGACGCATGCTGGAGCAGATCAAGGGCATCTCGGAGCAGAAGGCGACCAAGATCTTACACGAGGGT
GCTGCTCCCTAACGTGGACCGAGCGAGTGCATGCGCCCAGGCTAACCGTCGTGCACACAGCCTCCAAGCTGGTCC
CCATGGGCTTCACGACGGCGACCGAAATGCACCAGAGGCGAAGCGAGCTCATCTCCATCACCACCGGGTCCAAGA
ACCTAGACACCCTACTGGCCGGCGGCATCGAGACCGGCTCCGTCACCGAGCTCTTCGGCGAGTTCCGGACGGGTA
AGAGCCAGATATGCCACACGCTCGCCGTCACGTGCCAGCTGCCCTTCGACATGGGCGGCGGCGAGGGCAAGTGCC
TGTACATCGACACGGAGGGCACCTTTCGCCCCGTCAGGCTCCTGGCCGTCGCCAACCGCTTCGGCCTCTCGGGCG
AGGAGGTGCTCGACAACGTGGCCTACGCGCGCGCCTACAACTCGGACCACCAGCTGCAGCTCCTCAACCAGGCCG
CCGCCATGATGTGCGAGACGCGCTTCTCCCTGCTCGTTGTGGACAGCGCCACCGCCCTCTACCGCACCGACTTCT
GCGGCCGCGGCGAGCTGTCCAACCGGCAGACGCACCTGGCCAAGTTCATGCGCACCCTGCAGCGGCTCGCGGACG
AGTTCGGCATCGCCGTCGTCATCACGAACCAGGTCGTGGCCCAGGTCGACGGCGGGCCGAGCGCCATGTTCAACC
CGGATCCGAAGAAGCCCATTGGCGGCAATATCATTGCCCACGCCAGTACTACGAGGATCAGCCTGAAGAAGGGGC
GCGGCGAGACGCGTGTGGCCAAGATCTACGACAGCCCGTGCCTGCCGGAGAGCGACACGCTCTTTGCCATCAGCG
AGGACGGCATCGGCGATCCGGCTCCCAAGGACACGGACAAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail