Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2232
Gene name
LocationContig_152:40..2645
Strand-
Gene length (bp)2605
Transcript length (bp)2415
Coding sequence length (bp)2415
Protein length (aa) 805

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 1.3E-57 180 517
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 5.8E-51 523 800

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 170 800 7.0E-177
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 166 798 5.0E-99
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 166 798 8.0E-99
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 166 798 6.0E-98
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 167 798 3.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 170 800 7.0E-177
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 166 798 5.0E-99
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 166 798 8.0E-99
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 166 798 6.0E-98
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 167 798 3.0E-78
sp|Q9C5H9|GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana GN=GCP2 PE=1 SV=1 117 797 4.0E-71
sp|Q9XYP7|GCP2_DROME Gamma-tubulin complex component 2 homolog OS=Drosophila melanogaster GN=Grip84 PE=1 SV=2 158 791 1.0E-68
sp|P38863|SPC97_YEAST Spindle pole body component SPC97 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC97 PE=1 SV=1 173 744 1.0E-36
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 172 791 2.0E-29
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 172 785 7.0E-29
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 172 785 3.0E-28
sp|Q9XYP8|GCP3_DROME Gamma-tubulin complex component 3 homolog OS=Drosophila melanogaster GN=l(1)dd4 PE=1 SV=2 360 787 2.0E-19
sp|Q9USQ2|ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp6 PE=1 SV=2 377 789 2.0E-17
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 174 785 8.0E-16
sp|Q9M350|GACP4_ARATH Gamma-tubulin complex component 4 OS=Arabidopsis thaliana GN=GCP4 PE=2 SV=2 363 799 1.0E-15
sp|Q9SC88|GCP4_MEDTR Gamma-tubulin complex component 4 homolog OS=Medicago truncatula GN=85P PE=2 SV=1 363 799 4.0E-11
sp|Q9VKU7|GCP4_DROME Gamma-tubulin complex component 4 homolog OS=Drosophila melanogaster GN=Grip75 PE=1 SV=2 632 787 2.0E-07
sp|Q9UGJ1|GCP4_HUMAN Gamma-tubulin complex component 4 OS=Homo sapiens GN=TUBGCP4 PE=1 SV=1 646 785 2.0E-07
sp|Q9D4F8|GCP4_MOUSE Gamma-tubulin complex component 4 OS=Mus musculus GN=Tubgcp4 PE=1 SV=2 646 785 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0015631 tubulin binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2232
MSSGGTRAPSRANERSRPTAGGANGGGGGSGSGSFRGGGPDAKFPSTAHKRTASGNPRSASQAAEERRHEERRVT
ERTYEARIERVVRATSPDKAQKRAADRRPPGLRRQKSPEWRPRDAPAEPPQAQAPWNPEVTLLPRTSAPLASRVS
IPPLASTVPQAPQPKPLGELPLRVQEAAMVQDLLFVFMGYEGQYIRYAKGYDPAEERDRLSGPTFRILPGLDPSL
HDLTTSMLRMATYYSALVAFGDVQSRDDFGAVNHALCASVRRLLQDYLIMMAQLETQFLTSDTFTIHVLNIHTLS
TSQMMLQLYSLAQELLRRNGLLDDDSSEEDDDDSSEDYDRVIERLTDGGDLLPGNMTGKKICKGGVVLGILTKRL
ETMSGDPAARALLTSLLRDASRPYMVMLNEWLHHGAINDPHAEFLVREQKSIRRERLEQDYTDEYWERRYTMRDH
DVPPQLDGVKDKVLLAGKYLNVVRECGGVDVSKAVADLPASFDDGRFLDNVNGAYAHANESLMQLLLTTHALPAR
LWSMKHYFFLDPSDYFSYFLELGSSELRKPVKAVNTGKLQSLLDLVLRQPGSVVSLDPFKEDVKVEMNEITLIKS
LQRVVNITGIEQGEALQPLVAAAAAANNGQQQQQQQQPPADHDRNATGFTSLQLDYAVPFPVSLVISRKTVWRYQ
ALFRYLLSLRSLEAQLSATWQTQTRGLGWAHRGPNGALEVWKRRAWTLRARMLVFVQQLLYFCTAEVIEPNWTRF
MARLRPRDGAVTRTVDELMQDHVDFLDTCLKECMLTNSKLLRIHSKLMQTPTRT*
Coding >Hirsu2|2232
ATGTCGTCAGGCGGAACGAGAGCGCCGAGCCGCGCAAATGAGCGATCCAGGCCGACTGCCGGCGGTGCCAACGGC
GGAGGCGGCGGCAGCGGCAGCGGCAGCTTCCGGGGCGGCGGGCCCGACGCCAAGTTCCCCAGCACGGCGCACAAG
CGGACCGCGTCGGGGAACCCGCGGTCGGCGAGCCAGGCGGCCGAGGAGCGCCGCCACGAGGAGCGCCGCGTGACG
GAACGCACCTACGAGGCGCGCATCGAGAGGGTGGTGCGCGCGACGAGCCCGGACAAGGCGCAGAAGCGGGCGGCC
GATCGCCGGCCGCCGGGCCTGCGCCGCCAGAAGTCGCCCGAGTGGCGGCCCAGGGACGCGCCGGCCGAACCCCCC
CAAGCTCAAGCGCCGTGGAATCCCGAGGTGACGCTGCTGCCGCGCACGTCGGCGCCGCTGGCCTCGAGGGTGTCG
ATCCCGCCGCTCGCGTCGACGGTGCCCCAGGCGCCGCAGCCGAAGCCCCTCGGCGAGCTGCCGCTCCGGGTCCAG
GAGGCGGCCATGGTGCAGGACCTGCTGTTCGTCTTCATGGGATACGAGGGCCAGTACATCCGCTACGCCAAGGGC
TACGACCCCGCCGAGGAGCGCGATCGGCTGTCCGGGCCGACCTTCAGGATACTGCCGGGGCTCGACCCGAGCCTG
CACGACCTGACGACGTCGATGCTGAGGATGGCGACCTACTACTCGGCCCTCGTGGCCTTTGGCGACGTGCAGAGC
CGCGACGACTTCGGCGCCGTCAACCACGCCCTCTGCGCCTCCGTCCGGCGGCTGCTGCAGGACTACCTGATCATG
ATGGCGCAGCTGGAGACGCAGTTCCTGACGAGCGACACCTTCACGATCCACGTGCTCAACATACACACCCTCTCC
ACCAGCCAGATGATGCTGCAGCTGTACTCGCTGGCGCAGGAGCTCCTGCGGCGCAACGGCCTGCTCGACGACGAC
AGCTCGGAGGAGGACGACGACGACAGCTCGGAGGACTACGACCGGGTCATCGAGCGGCTGACGGACGGCGGCGAC
CTGCTGCCCGGCAACATGACGGGCAAGAAGATCTGCAAGGGCGGCGTCGTGCTCGGCATCCTGACGAAGCGGCTG
GAGACGATGTCGGGCGACCCGGCGGCGCGGGCGCTGCTGACGTCGCTGCTGCGCGACGCCAGCCGGCCGTACATG
GTGATGCTGAACGAGTGGCTGCACCACGGGGCCATCAACGACCCGCACGCCGAGTTCCTGGTCAGGGAGCAGAAG
AGCATCCGGCGCGAGCGGCTGGAGCAGGACTACACGGACGAGTACTGGGAGCGGCGGTACACGATGCGCGACCAC
GACGTGCCGCCGCAGCTGGACGGCGTCAAGGACAAGGTGCTGCTGGCGGGCAAGTACCTCAACGTGGTGCGCGAG
TGCGGCGGCGTCGACGTCAGCAAGGCGGTGGCGGACCTGCCGGCCTCGTTCGACGACGGGCGCTTCCTGGACAAC
GTCAACGGCGCGTACGCGCACGCCAACGAGTCGCTGATGCAGCTGCTGCTGACGACGCACGCGCTGCCGGCGCGG
CTGTGGTCGATGAAGCACTACTTCTTCCTCGACCCGTCCGACTACTTCTCCTACTTCCTCGAGCTCGGCTCGTCG
GAGCTGCGCAAGCCGGTCAAGGCGGTCAACACGGGCAAGCTGCAGTCGCTGCTGGACCTGGTGCTGCGCCAGCCC
GGCAGCGTCGTCTCGCTCGACCCCTTCAAGGAGGACGTCAAGGTGGAGATGAACGAGATCACGCTGATCAAGTCG
CTGCAGCGCGTCGTCAACATCACGGGCATCGAGCAGGGCGAGGCGCTGCAGCCGCTGGTGGCGGCGGCGGCGGCG
GCCAACAACGGCCAGCAGCAGCAGCAGCAGCAGCAGCCGCCGGCCGACCACGACCGCAACGCGACCGGCTTCACG
TCGCTGCAGCTCGACTACGCCGTGCCCTTCCCCGTGTCGCTCGTCATCAGCCGCAAGACGGTGTGGCGGTACCAG
GCGCTGTTCCGGTACCTGCTGTCGCTGCGCTCGCTCGAGGCGCAGCTGTCGGCGACGTGGCAGACGCAGACGCGC
GGCCTCGGCTGGGCGCACCGCGGGCCCAACGGCGCGCTCGAGGTCTGGAAGCGGCGCGCGTGGACGCTGCGGGCG
CGCATGCTCGTCTTCGTCCAGCAGCTGCTCTACTTCTGCACGGCCGAGGTCATCGAGCCCAACTGGACGCGCTTC
ATGGCCCGGCTGCGGCCGCGCGACGGCGCCGTCACCCGCACCGTCGACGAGCTGATGCAGGACCACGTCGACTTC
CTCGACACGTGCCTCAAGGAGTGCATGCTCACCAACAGCAAGCTCCTGCGCATCCACTCCAAGCTGATGCAGACG
CCGACCCGGACCTGA
Transcript >Hirsu2|2232
ATGTCGTCAGGCGGAACGAGAGCGCCGAGCCGCGCAAATGAGCGATCCAGGCCGACTGCCGGCGGTGCCAACGGC
GGAGGCGGCGGCAGCGGCAGCGGCAGCTTCCGGGGCGGCGGGCCCGACGCCAAGTTCCCCAGCACGGCGCACAAG
CGGACCGCGTCGGGGAACCCGCGGTCGGCGAGCCAGGCGGCCGAGGAGCGCCGCCACGAGGAGCGCCGCGTGACG
GAACGCACCTACGAGGCGCGCATCGAGAGGGTGGTGCGCGCGACGAGCCCGGACAAGGCGCAGAAGCGGGCGGCC
GATCGCCGGCCGCCGGGCCTGCGCCGCCAGAAGTCGCCCGAGTGGCGGCCCAGGGACGCGCCGGCCGAACCCCCC
CAAGCTCAAGCGCCGTGGAATCCCGAGGTGACGCTGCTGCCGCGCACGTCGGCGCCGCTGGCCTCGAGGGTGTCG
ATCCCGCCGCTCGCGTCGACGGTGCCCCAGGCGCCGCAGCCGAAGCCCCTCGGCGAGCTGCCGCTCCGGGTCCAG
GAGGCGGCCATGGTGCAGGACCTGCTGTTCGTCTTCATGGGATACGAGGGCCAGTACATCCGCTACGCCAAGGGC
TACGACCCCGCCGAGGAGCGCGATCGGCTGTCCGGGCCGACCTTCAGGATACTGCCGGGGCTCGACCCGAGCCTG
CACGACCTGACGACGTCGATGCTGAGGATGGCGACCTACTACTCGGCCCTCGTGGCCTTTGGCGACGTGCAGAGC
CGCGACGACTTCGGCGCCGTCAACCACGCCCTCTGCGCCTCCGTCCGGCGGCTGCTGCAGGACTACCTGATCATG
ATGGCGCAGCTGGAGACGCAGTTCCTGACGAGCGACACCTTCACGATCCACGTGCTCAACATACACACCCTCTCC
ACCAGCCAGATGATGCTGCAGCTGTACTCGCTGGCGCAGGAGCTCCTGCGGCGCAACGGCCTGCTCGACGACGAC
AGCTCGGAGGAGGACGACGACGACAGCTCGGAGGACTACGACCGGGTCATCGAGCGGCTGACGGACGGCGGCGAC
CTGCTGCCCGGCAACATGACGGGCAAGAAGATCTGCAAGGGCGGCGTCGTGCTCGGCATCCTGACGAAGCGGCTG
GAGACGATGTCGGGCGACCCGGCGGCGCGGGCGCTGCTGACGTCGCTGCTGCGCGACGCCAGCCGGCCGTACATG
GTGATGCTGAACGAGTGGCTGCACCACGGGGCCATCAACGACCCGCACGCCGAGTTCCTGGTCAGGGAGCAGAAG
AGCATCCGGCGCGAGCGGCTGGAGCAGGACTACACGGACGAGTACTGGGAGCGGCGGTACACGATGCGCGACCAC
GACGTGCCGCCGCAGCTGGACGGCGTCAAGGACAAGGTGCTGCTGGCGGGCAAGTACCTCAACGTGGTGCGCGAG
TGCGGCGGCGTCGACGTCAGCAAGGCGGTGGCGGACCTGCCGGCCTCGTTCGACGACGGGCGCTTCCTGGACAAC
GTCAACGGCGCGTACGCGCACGCCAACGAGTCGCTGATGCAGCTGCTGCTGACGACGCACGCGCTGCCGGCGCGG
CTGTGGTCGATGAAGCACTACTTCTTCCTCGACCCGTCCGACTACTTCTCCTACTTCCTCGAGCTCGGCTCGTCG
GAGCTGCGCAAGCCGGTCAAGGCGGTCAACACGGGCAAGCTGCAGTCGCTGCTGGACCTGGTGCTGCGCCAGCCC
GGCAGCGTCGTCTCGCTCGACCCCTTCAAGGAGGACGTCAAGGTGGAGATGAACGAGATCACGCTGATCAAGTCG
CTGCAGCGCGTCGTCAACATCACGGGCATCGAGCAGGGCGAGGCGCTGCAGCCGCTGGTGGCGGCGGCGGCGGCG
GCCAACAACGGCCAGCAGCAGCAGCAGCAGCAGCAGCCGCCGGCCGACCACGACCGCAACGCGACCGGCTTCACG
TCGCTGCAGCTCGACTACGCCGTGCCCTTCCCCGTGTCGCTCGTCATCAGCCGCAAGACGGTGTGGCGGTACCAG
GCGCTGTTCCGGTACCTGCTGTCGCTGCGCTCGCTCGAGGCGCAGCTGTCGGCGACGTGGCAGACGCAGACGCGC
GGCCTCGGCTGGGCGCACCGCGGGCCCAACGGCGCGCTCGAGGTCTGGAAGCGGCGCGCGTGGACGCTGCGGGCG
CGCATGCTCGTCTTCGTCCAGCAGCTGCTCTACTTCTGCACGGCCGAGGTCATCGAGCCCAACTGGACGCGCTTC
ATGGCCCGGCTGCGGCCGCGCGACGGCGCCGTCACCCGCACCGTCGACGAGCTGATGCAGGACCACGTCGACTTC
CTCGACACGTGCCTCAAGGAGTGCATGCTCACCAACAGCAAGCTCCTGCGCATCCACTCCAAGCTGATGCAGACG
CCGACCCGGACCTGA
Gene >Hirsu2|2232
ATGTCGTCAGGCGGAACGAGAGCGCCGAGCCGCGCAAATGAGCGATCCAGGCCGACTGCCGGCGGTGCCAACGGC
GGAGGCGGCGGCAGCGGCAGCGGCAGCTTCCGGGGCGGCGGGCCCGACGCCAAGTTCCCCAGCACGGCGCACAAG
CGGACCGCGTCGGGGAACCCGCGGTCGGCGAGCCAGGCGGCCGAGGAGCGCCGCCACGAGGAGCGCCGCGTGACG
GAACGCACCTACGAGGCGCGCATCGAGAGGGTGGTGCGCGCGACGAGCCCGGACAAGGCGCAGAAGCGGGCGGCC
GATCGCCGGCCGCCGGGCCTGCGCCGCCAGAAGTCGCCCGAGTGGCGGCCCAGGGACGCGCCGGCCGAACCCCCC
CAAGGTACCGTCACCACCGCCGGCCCTGCGGGACGCTCTGACTGACGGCGACGACGCGCCCAGCTCAAGCGCCGT
GGAATCCCGAGGTGACGCTGCTGCCGCGCACGTCGGCGCCGCTGGCCTCGAGGGTGTCGATCCCGCCGCTCGCGT
CGACGGTGCCCCAGGCGCCGCAGCCGAAGCCCCTCGGCGAGCTGCCGCTCCGGGTCCAGGAGGCGGCCATGGTGC
AGGACCTGCTGTTCGTCTTCATGGGATACGAGGGCCAGTACATCCGCTACGCCAAGGGCTACGACCCCGCCGAGG
AGCGCGATCGGCTGTCCGGGCCGACCTTCAGGATACTGCCGGGGCTCGACCCGAGCCTGCACGACCTGACGACGT
CGATGCTGAGGATGGCGACCTACTACTCGGCCCTCGTGGCCTTTGGCGACGTGCAGAGCCGCGACGACTTCGGCG
CCGTCAACCACGCCCTCTGCGCCTCCGTCCGGCGGCTGCTGCAGGACTACCTGATCATGATGGCGCAGCTGGAGA
CGCAGTTCCTGACGAGCGACACCTTCACGATCCACGTGCTCAACATACACACCCTCTCCACCAGCCAGATGATGC
TGCAGCTGTACTCGCTGGCGCAGGAGCTCCTGCGGCGCAACGGCCTGCTCGACGACGACAGCTCGGAGGAGGACG
ACGACGACAGCTCGGAGGACTACGACCGGGTCATCGAGCGGCTGACGGACGGCGGCGACCTGCTGCCCGGCAACA
TGACGGGCAAGAAGATCTGCAAGGGCGGCGTCGTGCTCGGCATCCTGACGAAGCGGCTGGAGACGATGTCGGGCG
ACCCGGCGGCGCGGGCGCTGCTGACGTCGCTGCTGCGCGACGCCAGCCGGCCGTACATGGTGATGCTGAACGAGT
GGCTGCACCACGGGGCCATCAACGACCCGCACGCCGAGTTCCTGGTCAGGGAGCAGAAGAGCATCCGGCGCGAGC
GGCTGGAGCAGGACTACACGGACGAGTACTGGGAGCGGCGGTACACGATGCGCGACCACGACGTGCCGCCGCAGC
TGGACGGCGTCAAGGACAAGGTGCTGCTGGCGGGCAAGTACCTCAACGTGGTGCGCGAGTGCGGCGGCGTCGACG
TCAGCAAGGCGGTGGCGGACCTGCCGGCCTCGTTCGACGACGGGCGCTTCCTGGACAACGTCAACGGCGCGTACG
CGCACGCCAACGAGTCGCTGATGCAGCTGCTGCTGACGACGCACGCGCTGCCGGCGCGGCTGTGGTCGATGAAGC
ACTACTTCTTCCTCGACCCGTCCGACTACTTCTCCTACTTCCTCGAGCTCGGCTCGTCGGAGCTGCGCAAGCCGG
TCAAGGCGGTCAACACGGGCAAGCTGCAGTCGCTGCTGGACCTGGTGCTGCGCCAGCCCGGCAGCGTCGTCTCGC
TCGACCCCTTCAAGGAGGACGTCAAGGTGGAGATGAACGAGATCACGCTGATCAAGTCGCTGCAGCGCGTCGTCA
ACATCACGGGCATCGAGCAGGGCGAGGCGCTGCAGCCGCTGGTGGCGGCGGCGGCGGCGGCCAACAACGGCCAGC
AGCAGCAGCAGCAGCAGCAGCCGCCGGCCGACCACGACCGCAACGCGACCGGCTTCACGTCGCTGCAGCTCGACT
ACGCCGTGCCCTTCCCCGTGTCGCTCGTCATCAGCCGCAAGACGGTGTGGCGGTACCAGGCGCTGTTCCGGTACC
TGCTGTCGCTGCGCTCGCTCGAGGCGCAGCTGTCGGCGACGTGGCAGACGCAGACGCGCGGCCTCGGCTGGGCGC
ACCGCGGGCCCAACGGCGCGCTCGAGGTCTGGAAGCGGCGCGCGTGGACGCTGCGGGCGCGCATGCTCGTCTTCG
TCCAGCAGCTGCTCTACTTCTGCACGGCCGAGGTCATCGAGCCCAACTGGACGCGCTTCATGGCCCGGCTGCGGC
CGCGCGACGGCGCCGTCACCCGCACCGTCGACGAGCTGATGCAGGACCACGTCGACTTCCTCGACACGTGCCTCA
AGGAGTGCATGCTCACCAACAGCAAGCTCCTGCGCGTGCGTCCTCGCCTCTCCCCTCTTCCACTCTCCCCGTCCC
GATCCGGGTCCGCCCGCCCGCTGACCGCGCCCGCCGCAGATCCACTCCAAGCTGATGCAGACGTGCACCATCTTC
GCCGCCTACACCGGCTGGCTGACGCGCGAGCTGGAAAAGGCCGACCCGGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail