Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2226
Gene name
LocationContig_1518:2321..3117
Strand-
Gene length (bp)796
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Cell membrane 0.577 0.3831 0.0297 0.5964 0.1828 0.0554 0.2062 0.1764 0.1661 0.1944

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9011
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2226 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2226
MAPEAADFIPTGTAEVVLSGASLSLSAPVDAAAVAAAAAAGFLRLGSMTTPRFQELQVMGRHHTIRFDKRQQALR
TASSMTLGTRDFNDLDFSAFASLPHNKKHIVAAIDHPLSRTSATDKLRPPPPVRRPDNWRSLSLFKTMCLWGKLR
SDSEQEAFDENGGDRPFSQQLERSQRLESR*
Coding >Hirsu2|2226
ATGGCACCAGAGGCGGCAGATTTTATCCCTACGGGGACTGCCGAGGTTGTGCTCTCCGGGGCCTCTCTCTCTCTC
TCTGCCCCTGTCGACGCCGCCGCCGTAGCTGCTGCTGCTGCTGCCGGCTTTTTACGTCTGGGTTCCATGACCACC
CCTCGCTTCCAGGAACTCCAAGTCATGGGCCGTCATCACACGATTCGCTTCGACAAACGGCAGCAAGCCCTCCGC
ACGGCCTCATCAATGACCCTCGGCACCAGGGACTTTAACGATCTCGACTTCTCAGCCTTCGCCTCCCTGCCTCAC
AACAAGAAACACATAGTCGCGGCTATTGATCATCCCCTTTCACGGACATCTGCAACTGACAAGCTTCGACCGCCG
CCCCCTGTGCGGCGGCCTGATAACTGGAGGTCATTGTCGCTGTTTAAGACCATGTGTTTATGGGGAAAGCTTCGG
TCCGATTCGGAGCAGGAGGCCTTCGATGAAAACGGGGGAGACCGACCCTTTTCCCAACAACTCGAACGATCCCAA
AGACTTGAATCCCGATGA
Transcript >Hirsu2|2226
ATGGCACCAGAGGCGGCAGATTTTATCCCTACGGGGACTGCCGAGGTTGTGCTCTCCGGGGCCTCTCTCTCTCTC
TCTGCCCCTGTCGACGCCGCCGCCGTAGCTGCTGCTGCTGCTGCCGGCTTTTTACGTCTGGGTTCCATGACCACC
CCTCGCTTCCAGGAACTCCAAGTCATGGGCCGTCATCACACGATTCGCTTCGACAAACGGCAGCAAGCCCTCCGC
ACGGCCTCATCAATGACCCTCGGCACCAGGGACTTTAACGATCTCGACTTCTCAGCCTTCGCCTCCCTGCCTCAC
AACAAGAAACACATAGTCGCGGCTATTGATCATCCCCTTTCACGGACATCTGCAACTGACAAGCTTCGACCGCCG
CCCCCTGTGCGGCGGCCTGATAACTGGAGGTCATTGTCGCTGTTTAAGACCATGTGTTTATGGGGAAAGCTTCGG
TCCGATTCGGAGCAGGAGGCCTTCGATGAAAACGGGGGAGACCGACCCTTTTCCCAACAACTCGAACGATCCCAA
AGACTTGAATCCCGATGA
Gene >Hirsu2|2226
ATGGCACCAGAGGCGGCAGATTTTATCCCTACGTGCGTTCTTCCCGATTCCTATTCAGCTGGTTAGCGCTAACAA
GTTGTAGGGGGACTGCCGAGGTTGTGCTCTCCGGGGCCTCTCTCTCTCTCTCTGCCCCTGTCGACGCCGCCGCCG
TAGCTGCTGCTGCTGCTGCCGGCTTTTTACGTCTGGGTTCCATGACCACCCCTCGCTTCCAGGAACTCCAAGTCA
TGGGCCGTCATCACACGATTCGCTTCGACAAACGGCAGCAAGCCCTCCGCACGGCCTGTTTTGGCACACGCCATC
CATTCCGATACCGCTATCCTGAGACGCTCTATTTTAGGGAGACTTTTGTCAATTACACCGCGAAACCAGCCTCCG
CGCAGGCTCGACCACCTCATCGTCTTATTAGACTGATCCATCGCCAGCATCAATGACCCTCGGCACCAGGGACTT
TAACGATCTCGACTTCTCAGCCTTCGCCTCCCTGCCTCACAACAAGAAACACATAGTCGCGGCTATTGATCATCC
CCTTTCACGGACATCTGCAACTGACAAGCTTCGACCGCCGCCCCCTGTGCGGCGGCCTGATAACTGGTGAGGATC
ACGGCCCTCGTCCTCACCATTTTTCAGCGAGAGCATCGCTAATGCCCCGCATAGGAGGTCATTGTCGCTGTTTAA
GACCATGTGTTTATGGGGAAAGCTTCGGTCCGATTCGGAGCAGGAGGCCTTCGATGAAAACGGGGGAGACCGACC
CTTTTCCCAACAACTCGAACGATCCCAAAGACTTGAATCCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail