Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2223
Gene name
LocationContig_1517:3631..4060
Strand+
Gene length (bp)429
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1626 0.1146 0.9367 0.0572 0.1526 0.0608 0.0614 0.0448 0.1452 0.0057

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999757

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7518
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2223 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2223
MKHSTAALLLAVASLAVAAPAGADLPAPIEPEQQQAICAKLGLDEATCRPRIDKCVTDAFADPDSDKSAAALEAC
VAETPPADLPAPIEPEQQQAICAKLGLGDADCRARIDKCVTDAFADPAGDKSPEALEKCVARTKKST*
Coding >Hirsu2|2223
ATGAAGCACTCCACCGCTGCTCTCCTCCTGGCAGTCGCCAGCCTGGCCGTGGCCGCGCCCGCCGGCGCCGACCTG
CCGGCGCCCATCGAGCCGGAGCAGCAGCAGGCCATCTGCGCGAAGCTCGGGCTGGACGAGGCCACCTGCCGCCCG
CGCATCGACAAGTGCGTCACCGACGCCTTCGCGGACCCGGACAGCGACAAGTCTGCCGCGGCGCTCGAAGCCTGC
GTAGCCGAGACCCCGCCGGCCGACCTGCCGGCGCCCATCGAGCCGGAGCAGCAGCAGGCCATCTGCGCGAAGCTC
GGGCTGGGCGACGCCGACTGCCGCGCGCGCATCGACAAGTGCGTCACCGACGCCTTCGCGGACCCGGCCGGCGAC
AAGTCGCCCGAGGCGCTCGAGAAGTGCGTGGCGAGGACGAAGAAGAGCACGTAA
Transcript >Hirsu2|2223
ATGAAGCACTCCACCGCTGCTCTCCTCCTGGCAGTCGCCAGCCTGGCCGTGGCCGCGCCCGCCGGCGCCGACCTG
CCGGCGCCCATCGAGCCGGAGCAGCAGCAGGCCATCTGCGCGAAGCTCGGGCTGGACGAGGCCACCTGCCGCCCG
CGCATCGACAAGTGCGTCACCGACGCCTTCGCGGACCCGGACAGCGACAAGTCTGCCGCGGCGCTCGAAGCCTGC
GTAGCCGAGACCCCGCCGGCCGACCTGCCGGCGCCCATCGAGCCGGAGCAGCAGCAGGCCATCTGCGCGAAGCTC
GGGCTGGGCGACGCCGACTGCCGCGCGCGCATCGACAAGTGCGTCACCGACGCCTTCGCGGACCCGGCCGGCGAC
AAGTCGCCCGAGGCGCTCGAGAAGTGCGTGGCGAGGACGAAGAAGAGCACGTAA
Gene >Hirsu2|2223
ATGAAGCACTCCACCGCTGCTCTCCTCCTGGCAGTCGCCAGCCTGGCCGTGGCCGCGCCCGCCGGCGCCGACCTG
CCGGCGCCCATCGAGCCGGAGCAGCAGCAGGCCATCTGCGCGAAGCTCGGGCTGGACGAGGCCACCTGCCGCCCG
CGCATCGACAAGTGCGTCACCGACGCCTTCGCGGACCCGGACAGCGACAAGTCTGCCGCGGCGCTCGAAGCCTGC
GTAGCCGAGACCCCGCCGGCCGACCTGCCGGCGCCCATCGAGCCGGAGCAGCAGCAGGCCATCTGCGCGAAGCTC
GGGCTGGGCGACGCCGACTGCCGCGCGCGCATCGACAAGTGCGTCACCGACGCCTTCGCGGACCCGGCCGGCGAC
AAGTCGCCCGAGGCGCTCGAGAAGTGCGTGGCGAGGACGAAGAAGAGCACGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail