Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2216
Gene name
LocationContig_1514:4540..5132
Strand-
Gene length (bp)592
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7267 0.6955 0.0859 0.0857 0.1115 0.0049 0.3357 0.0811 0.0723 0.0504

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6554
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2216 (this protein)
Ophiocordyceps subramaniannii Hirsu2|301
Ophiocordyceps subramaniannii Hirsu2|4323
Ophiocordyceps subramaniannii Hirsu2|8922

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2216
MDHKAFHANGLPGDSKPFNAHDGNPLSEVPQLDHESSTIPSSSPSTADLGSAAFPTTLNPQAPWFDFSSPPALPG
GPFPDTYVLPSFEQNFQNPITNNDDIKWVLTGMMFRLDALELAISTANLHISQVQEGVAEILRQSQSTEDIAQAI
EGLKKSLKELVTSLVLHLLGGDGTEDVEM*
Coding >Hirsu2|2216
ATGGATCACAAGGCTTTCCACGCGAATGGACTCCCAGGCGATTCGAAGCCGTTCAATGCACACGATGGTAATCCA
TTATCAGAGGTCCCGCAACTAGACCACGAATCCTCTACGATCCCCTCAAGCTCACCGTCTACGGCGGACTTAGGA
TCGGCCGCCTTTCCTACGACATTAAACCCACAAGCTCCTTGGTTCGACTTTAGCAGTCCTCCTGCTCTGCCCGGT
GGGCCTTTTCCTGATACCTATGTTCTGCCATCATTCGAGCAAAACTTTCAGAACCCCATAACGAATAATGACGAT
ATCAAGTGGGTGCTTACCGGCATGATGTTTCGCCTTGATGCTTTAGAGCTAGCTATTTCGACGGCAAATTTGCAC
ATAAGTCAAGTACAAGAGGGGGTTGCTGAGATACTCAGGCAATCACAATCTACCGAAGATATTGCCCAGGCGATT
GAAGGCCTTAAGAAAAGCTTGAAGGAGCTGGTAACGTCGTTAGTGCTGCATCTATTAGGTGGTGACGGGACTGAA
GATGTCGAAATGTAG
Transcript >Hirsu2|2216
ATGGATCACAAGGCTTTCCACGCGAATGGACTCCCAGGCGATTCGAAGCCGTTCAATGCACACGATGGTAATCCA
TTATCAGAGGTCCCGCAACTAGACCACGAATCCTCTACGATCCCCTCAAGCTCACCGTCTACGGCGGACTTAGGA
TCGGCCGCCTTTCCTACGACATTAAACCCACAAGCTCCTTGGTTCGACTTTAGCAGTCCTCCTGCTCTGCCCGGT
GGGCCTTTTCCTGATACCTATGTTCTGCCATCATTCGAGCAAAACTTTCAGAACCCCATAACGAATAATGACGAT
ATCAAGTGGGTGCTTACCGGCATGATGTTTCGCCTTGATGCTTTAGAGCTAGCTATTTCGACGGCAAATTTGCAC
ATAAGTCAAGTACAAGAGGGGGTTGCTGAGATACTCAGGCAATCACAATCTACCGAAGATATTGCCCAGGCGATT
GAAGGCCTTAAGAAAAGCTTGAAGGAGCTGGTAACGTCGTTAGTGCTGCATCTATTAGGTGGTGACGGGACTGAA
GATGTCGAAATGTAG
Gene >Hirsu2|2216
ATGGATCACAAGGCTTTCCACGCGAATGGACTCCCAGGCGATTCGAAGCCGTTCAATGCACACGATGGTAATCCA
TTATCAGAGGTCCCGCAACTAGACCACGAATCCTCTACGATCCCCTCAAGCTCACCGTCTACGGCGGACTTAGGA
TCGGCCGCCTTTCCTACGACATTAAACCCACAAGCTCCTTGGTTCGACTTTAGCAGTCCTCCTGCTCTGCCCGGT
GGGCCTTTTCCTGATACCTATGTTCTGCCATCATTCGAGCAAAACTTTCAGAACCCCATAACGAATAATGACGAT
ATCAAGTGGTGAGTCTCGTTTAAACATGAAATGAGCTGTAGCTAAAGTATTTCATGTTAGGGTGCTTACCGGCAT
GATGTTTCGCCTTGATGCTTTAGAGCTAGCTATTTCGACGGCAAATTTGCACATAAGTCAAGTACAAGAGGGGGT
TGCTGAGATACTCAGGCAATCACAATCTACCGAAGATATTGCCCAGGCGATTGAAGGCCTTAAGAAAAGCTTGAA
GGAGCTGGTAACGTCGTTAGTGCTGCATCTATTAGGTGGTGACGGGACTGAAGATGTCGAAATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail