Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2212
Gene name
LocationContig_1513:45..306
Strand+
Gene length (bp)261
Transcript length (bp)261
Coding sequence length (bp)261
Protein length (aa) 87

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 1.9E-05 1 37
PF13637 Ank_4 Ankyrin repeats (many copies) 2.9E-09 17 69
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.1E-12 2 72
PF00023 Ank Ankyrin repeat 6.1E-05 17 48
PF13606 Ank_3 Ankyrin repeat 2.0E-04 17 45

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 4 71 6.0E-08
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 2 71 1.0E-07
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 1 71 5.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 5 81 6.0E-07
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 8 71 9.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 4 71 6.0E-08
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 2 71 1.0E-07
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 1 71 5.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 5 81 6.0E-07
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 8 71 9.0E-07
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 1 71 2.0E-06
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 7 74 4.0E-06
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 2 74 5.0E-06
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 2 74 5.0E-06
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 1 76 5.0E-06
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 8 74 6.0E-06
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 1 71 6.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 7 71 7.0E-06
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 1 71 7.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 2 71 8.0E-06
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 7 74 8.0E-06
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 7 72 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2212
LLLDAPGVDAEARDAAGRTPLWFAVRAGHEAVVRLLLATGRVNPNEADDQGQTPLMMAHKQGNAAILRLVLARAR
LAQILGLPRTR*
Coding >Hirsu2|2212
CTGCTGCTCGACGCGCCCGGAGTCGACGCCGAAGCCCGTGACGCCGCCGGCCGCACCCCGCTGTGGTTCGCCGTG
CGCGCCGGGCACGAGGCCGTCGTCCGCCTGCTGCTCGCCACCGGCCGCGTCAACCCCAACGAGGCCGACGACCAG
GGCCAGACGCCGCTGATGATGGCGCACAAGCAGGGCAACGCCGCGATTCTGCGCCTGGTGCTGGCGCGCGCACGC
CTGGCCCAGATCCTCGGCCTGCCGCGCACGAGGTAG
Transcript >Hirsu2|2212
CTGCTGCTCGACGCGCCCGGAGTCGACGCCGAAGCCCGTGACGCCGCCGGCCGCACCCCGCTGTGGTTCGCCGTG
CGCGCCGGGCACGAGGCCGTCGTCCGCCTGCTGCTCGCCACCGGCCGCGTCAACCCCAACGAGGCCGACGACCAG
GGCCAGACGCCGCTGATGATGGCGCACAAGCAGGGCAACGCCGCGATTCTGCGCCTGGTGCTGGCGCGCGCACGC
CTGGCCCAGATCCTCGGCCTGCCGCGCACGAGGTAG
Gene >Hirsu2|2212
CTGCTGCTCGACGCGCCCGGAGTCGACGCCGAAGCCCGTGACGCCGCCGGCCGCACCCCGCTGTGGTTCGCCGTG
CGCGCCGGGCACGAGGCCGTCGTCCGCCTGCTGCTCGCCACCGGCCGCGTCAACCCCAACGAGGCCGACGACCAG
GGCCAGACGCCGCTGATGATGGCGCACAAGCAGGGCAACGCCGCGATTCTGCGCCTGGTGCTGGCGCGCGCACGC
CTGGCCCAGATCCTCGGCCTGCCGCGCACGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail