Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2203
Gene name
LocationContig_1510:1296..2107
Strand-
Gene length (bp)811
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03248 Rer1 Rer1 family 1.8E-62 27 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5PJ65|RER1_BOVIN Protein RER1 OS=Bos taurus GN=RER1 PE=2 SV=2 28 154 2.0E-55
sp|Q498C8|RER1_RAT Protein RER1 OS=Rattus norvegicus GN=Rer1 PE=1 SV=1 28 154 3.0E-55
sp|Q9CQU3|RER1_MOUSE Protein RER1 OS=Mus musculus GN=Rer1 PE=1 SV=1 28 154 3.0E-55
sp|Q5R5U4|RER1_PONAB Protein RER1 OS=Pongo abelii GN=RER1 PE=2 SV=1 28 156 1.0E-54
sp|O15258|RER1_HUMAN Protein RER1 OS=Homo sapiens GN=RER1 PE=1 SV=1 28 156 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5PJ65|RER1_BOVIN Protein RER1 OS=Bos taurus GN=RER1 PE=2 SV=2 28 154 2.0E-55
sp|Q498C8|RER1_RAT Protein RER1 OS=Rattus norvegicus GN=Rer1 PE=1 SV=1 28 154 3.0E-55
sp|Q9CQU3|RER1_MOUSE Protein RER1 OS=Mus musculus GN=Rer1 PE=1 SV=1 28 154 3.0E-55
sp|Q5R5U4|RER1_PONAB Protein RER1 OS=Pongo abelii GN=RER1 PE=2 SV=1 28 156 1.0E-54
sp|O15258|RER1_HUMAN Protein RER1 OS=Homo sapiens GN=RER1 PE=1 SV=1 28 156 1.0E-54
sp|Q5ZHM5|RER1_CHICK Protein RER1 OS=Gallus gallus GN=RER1 PE=2 SV=1 28 154 1.0E-54
sp|O48670|RER1A_ARATH Protein RER1A OS=Arabidopsis thaliana GN=RER1A PE=1 SV=1 29 157 6.0E-50
sp|Q10358|RER1_SCHPO Protein rer1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rer1 PE=3 SV=1 28 156 6.0E-50
sp|P25560|RER1_YEAST Protein RER1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RER1 PE=1 SV=2 28 157 8.0E-50
sp|O48671|RER1B_ARATH Protein RER1B OS=Arabidopsis thaliana GN=RER1B PE=1 SV=2 29 154 9.0E-50
sp|Q9ZWI7|RER1C_ARATH Protein RER1C OS=Arabidopsis thaliana GN=RER1C PE=2 SV=1 28 156 3.0E-49
sp|P79003|RER1_SACPS Protein RER1 OS=Saccharomyces pastorianus GN=RER1 PE=3 SV=1 28 157 3.0E-48
sp|Q54D10|RER1_DICDI Protein RER1 homolog OS=Dictyostelium discoideum GN=rer1 PE=3 SV=1 28 157 2.0E-46
sp|Q9ZPV7|RER1D_ARATH Protein RER1D OS=Arabidopsis thaliana GN=At2g18240 PE=2 SV=2 28 150 5.0E-39
sp|P52879|RER1_CAEEL Protein RER1 homolog OS=Caenorhabditis elegans GN=rer-1 PE=3 SV=1 28 150 1.0E-38
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 28 47 19
2 109 131 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2203
MDAPETDQTPFASVTAHTSRLQRVRLRWYIVAYALGIYLLNLFLAFLQPKFDPSNDAIDNEMEDGSVGMLPTKQD
EEFKPFIRRLPEFKFWYWATRAIAISFFCTFFELFNVPVFWPVLVMYWIILFVLTMRKQIQHMVKYRYVPFTIGK
KNYNKNSP*
Coding >Hirsu2|2203
ATGGATGCGCCGGAAACCGACCAGACGCCCTTCGCCAGCGTCACGGCGCACACGTCTCGGCTGCAGAGGGTACGG
CTACGCTGGTACATTGTGGCGTACGCCCTCGGCATCTACCTCCTCAACCTCTTCCTCGCCTTCCTGCAGCCCAAG
TTTGACCCGTCCAACGATGCCATTGACAACGAGATGGAGGACGGCTCGGTCGGCATGTTGCCGACGAAGCAGGAC
GAGGAGTTCAAGCCCTTCATCCGCCGCCTACCCGAGTTCAAGTTCTGGTACTGGGCCACGAGGGCCATTGCCATT
TCCTTCTTCTGCACCTTCTTCGAGCTCTTCAACGTGCCCGTCTTCTGGCCCGTGCTCGTCATGTACTGGATCATC
CTCTTCGTCCTGACCATGCGGAAGCAGATCCAGCACATGGTCAAGTATCGCTACGTGCCGTTCACCATCGGCAAG
AAGAACTACAACAAGAACAGCCCGTAG
Transcript >Hirsu2|2203
ATGGATGCGCCGGAAACCGACCAGACGCCCTTCGCCAGCGTCACGGCGCACACGTCTCGGCTGCAGAGGGTACGG
CTACGCTGGTACATTGTGGCGTACGCCCTCGGCATCTACCTCCTCAACCTCTTCCTCGCCTTCCTGCAGCCCAAG
TTTGACCCGTCCAACGATGCCATTGACAACGAGATGGAGGACGGCTCGGTCGGCATGTTGCCGACGAAGCAGGAC
GAGGAGTTCAAGCCCTTCATCCGCCGCCTACCCGAGTTCAAGTTCTGGTACTGGGCCACGAGGGCCATTGCCATT
TCCTTCTTCTGCACCTTCTTCGAGCTCTTCAACGTGCCCGTCTTCTGGCCCGTGCTCGTCATGTACTGGATCATC
CTCTTCGTCCTGACCATGCGGAAGCAGATCCAGCACATGGTCAAGTATCGCTACGTGCCGTTCACCATCGGCAAG
AAGAACTACAACAAGAACAGCCCGTAG
Gene >Hirsu2|2203
ATGGATGCGCCGGAAACCGACCAGACGCCCTTCGCCAGCGTCACGGCGCACACGTCTCGGCTGCAGAGGGTACGG
CTACGTTTCCCTTTTTTTTTTTTTGCCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNCCCTCCTCCTCTTCTTCCTCCGCGTCTTTTTCGCCCAAGGCTGGTACATTGGTGCGTCGTC
GCCCGGCCCTTGACGCTCCATCAGGAGGCGCTCTCGCTAACGCGCGACAGTGGCGTACGCCCTCGGCATCTACCT
CCTCAACCTCTTCCTCGCCTTCCTGCAGCCCAAGTTTGACCCGTCCAACGATGCCATTGACAACGAGATGGAGGA
CGGCTCGGTCGGCATGTTGCCGACGAAGCAGGACGAGGAGTTCAAGCCCTTCATCCGCCGCCTACCCGAGTTCAA
GTTCTGGTACTGGGCCACGAGGGCCATTGCCATTTCCTTCTTCTGCACCTTCTTCGAGCTCTTCAACGTGCCCGT
CTTCTGGCCCGTGCTCGTCATGTACTGGATCATCCTCTTCGTCCTGACCAGTAAGTCCCCCCCCCCCCCCGGGCC
CCTCCTGCGACCGAGAGGGCGCTGGAGCTGACGCGATGCCTCGTCTCCAGTGCGGAAGCAGATCCAGCACATGGT
CAAGTATCGCTACGTGCCGTTCACCATCGGCAAGAAGAACTACAACAAGAACAGCCCGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail