Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2179
Gene name
LocationContig_1503:1691..4529
Strand-
Gene length (bp)2838
Transcript length (bp)2697
Coding sequence length (bp)2697
Protein length (aa) 899

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.3E-68 626 894
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.1E-49 628 888
PF14847 Ras_bdg_2 Ras-binding domain of Byr2 1.9E-25 244 345
PF00536 SAM_1 SAM domain (Sterile alpha motif) 3.0E-15 69 131
PF07647 SAM_2 SAM domain (Sterile alpha motif) 6.5E-14 67 131
PF00788 RA Ras association (RalGDS/AF-6) domain 6.0E-13 242 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 600 894 4.0E-96
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 624 894 6.0E-96
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 624 894 9.0E-95
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 623 894 1.0E-78
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 624 894 9.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 600 894 4.0E-96
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 624 894 6.0E-96
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 624 894 9.0E-95
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 623 894 1.0E-78
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 624 894 9.0E-78
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 623 894 1.0E-75
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 623 895 1.0E-74
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 623 894 1.0E-73
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 623 894 4.0E-73
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 624 893 1.0E-70
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 624 893 1.0E-66
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 624 893 1.0E-66
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 624 894 1.0E-65
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 624 894 1.0E-64
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 623 894 2.0E-63
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 624 894 2.0E-58
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 624 894 3.0E-58
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 624 894 6.0E-55
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 624 895 1.0E-54
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 621 894 2.0E-54
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 624 895 3.0E-54
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 621 894 3.0E-54
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 624 895 3.0E-54
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 621 894 3.0E-53
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 627 894 4.0E-53
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 627 889 6.0E-53
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 620 894 1.0E-52
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 620 894 2.0E-52
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 620 894 4.0E-52
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 624 894 4.0E-52
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 627 894 3.0E-50
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 598 896 1.0E-49
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 629 896 3.0E-49
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 581 894 1.0E-47
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 582 894 2.0E-47
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 582 894 4.0E-47
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 630 895 8.0E-47
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 623 894 9.0E-47
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 628 894 2.0E-46
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 628 894 4.0E-46
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 623 895 6.0E-45
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 630 894 6.0E-44
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 623 898 1.0E-43
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 624 894 2.0E-43
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 623 898 3.0E-43
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 609 897 3.0E-43
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 593 894 3.0E-43
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 593 894 5.0E-43
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 593 894 5.0E-43
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 593 894 5.0E-43
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 593 894 5.0E-43
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 583 894 1.0E-42
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 593 894 1.0E-42
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 583 894 2.0E-42
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 583 894 3.0E-42
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 630 898 3.0E-42
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 630 894 4.0E-42
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 630 898 4.0E-42
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 630 894 6.0E-42
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 616 898 7.0E-42
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 604 894 1.0E-41
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 604 894 1.0E-41
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 604 894 2.0E-41
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 623 897 2.0E-41
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 583 894 3.0E-41
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 599 897 3.0E-41
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 630 898 3.0E-41
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 599 897 5.0E-41
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 604 894 7.0E-41
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 630 897 2.0E-40
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 630 894 4.0E-40
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 630 894 5.0E-40
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 630 894 5.0E-40
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 630 894 6.0E-40
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 624 898 9.0E-40
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 624 895 1.0E-39
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 624 894 1.0E-39
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 630 894 2.0E-39
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 630 894 2.0E-39
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 630 894 2.0E-39
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 630 894 2.0E-39
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 630 894 2.0E-39
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 630 894 2.0E-39
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 630 894 3.0E-39
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 630 894 4.0E-39
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 624 898 4.0E-39
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 630 895 5.0E-39
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 630 895 7.0E-39
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 624 889 8.0E-39
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 630 895 9.0E-39
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 621 894 1.0E-38
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 629 894 1.0E-38
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 624 898 2.0E-38
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 630 894 2.0E-38
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 624 898 2.0E-38
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 630 895 3.0E-38
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 630 894 5.0E-38
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 624 898 5.0E-38
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 630 894 5.0E-38
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 630 894 5.0E-38
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 630 894 7.0E-38
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 630 894 7.0E-38
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 630 894 7.0E-38
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 630 894 8.0E-38
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 630 894 1.0E-37
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 630 894 1.0E-37
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 629 850 1.0E-37
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 630 893 2.0E-37
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 630 893 3.0E-37
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 630 894 3.0E-37
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 630 894 3.0E-37
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 630 894 4.0E-37
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 630 898 4.0E-37
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 623 895 4.0E-37
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 630 875 5.0E-37
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 630 872 6.0E-37
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 629 889 6.0E-37
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 630 895 7.0E-37
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 630 895 7.0E-37
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 630 895 7.0E-37
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 630 895 7.0E-37
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 630 895 8.0E-37
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 630 894 8.0E-37
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 623 897 1.0E-36
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 630 895 1.0E-36
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 623 897 1.0E-36
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 620 894 1.0E-36
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 630 895 3.0E-36
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 630 898 4.0E-36
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 630 894 5.0E-36
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 631 894 5.0E-36
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 607 897 7.0E-36
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 631 894 7.0E-36
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 624 894 7.0E-36
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 630 895 8.0E-36
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 629 897 9.0E-36
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 631 894 1.0E-35
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 630 894 1.0E-35
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 622 894 1.0E-35
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 631 894 1.0E-35
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 611 894 1.0E-35
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 624 850 1.0E-35
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 630 895 2.0E-35
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 630 894 2.0E-35
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 630 895 2.0E-35
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 624 898 2.0E-35
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 622 894 2.0E-35
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 604 894 4.0E-35
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 627 894 4.0E-35
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 630 897 5.0E-35
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 623 894 5.0E-35
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 622 894 6.0E-35
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 619 889 7.0E-35
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 630 894 8.0E-35
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 630 894 9.0E-35
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 623 849 1.0E-34
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 622 889 1.0E-34
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 624 850 1.0E-34
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 630 894 1.0E-34
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 630 894 2.0E-34
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 624 897 2.0E-34
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 622 889 2.0E-34
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 630 889 3.0E-34
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 620 838 3.0E-34
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 631 895 4.0E-34
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 623 854 4.0E-34
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 623 889 4.0E-34
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 623 889 5.0E-34
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 627 894 6.0E-34
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 534 895 7.0E-34
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 629 894 7.0E-34
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 627 895 7.0E-34
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 629 894 9.0E-34
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 630 889 9.0E-34
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 623 895 9.0E-34
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 623 894 1.0E-33
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 614 895 1.0E-33
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 628 898 1.0E-33
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 623 876 2.0E-33
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 630 850 2.0E-33
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 630 894 2.0E-33
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 629 894 2.0E-33
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 630 896 3.0E-33
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 622 889 3.0E-33
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 630 896 3.0E-33
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 627 894 3.0E-33
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 624 894 3.0E-33
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 629 898 4.0E-33
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 630 894 5.0E-33
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 630 850 5.0E-33
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 622 884 5.0E-33
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 624 894 5.0E-33
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 630 850 5.0E-33
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 623 895 6.0E-33
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 624 897 6.0E-33
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 627 850 6.0E-33
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 622 895 7.0E-33
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 630 894 7.0E-33
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 630 894 7.0E-33
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 624 895 7.0E-33
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 624 897 7.0E-33
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 637 857 8.0E-33
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 629 894 8.0E-33
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 624 895 9.0E-33
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 630 890 9.0E-33
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 630 850 9.0E-33
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 624 894 9.0E-33
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 623 894 1.0E-32
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 627 840 1.0E-32
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 630 890 1.0E-32
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 630 883 1.0E-32
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 624 894 2.0E-32
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 622 895 2.0E-32
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 630 894 2.0E-32
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 630 894 2.0E-32
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 630 850 2.0E-32
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 624 895 2.0E-32
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 630 894 2.0E-32
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 544 896 3.0E-32
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 624 895 3.0E-32
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 628 838 3.0E-32
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 630 894 3.0E-32
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 627 876 3.0E-32
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 630 883 4.0E-32
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 630 890 4.0E-32
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 623 884 4.0E-32
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 629 894 4.0E-32
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 613 884 4.0E-32
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 630 894 5.0E-32
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 623 871 5.0E-32
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 624 876 5.0E-32
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 630 890 5.0E-32
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 630 883 6.0E-32
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 623 838 6.0E-32
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 623 889 7.0E-32
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 630 894 7.0E-32
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 630 894 7.0E-32
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 630 897 7.0E-32
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 630 897 8.0E-32
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 623 889 9.0E-32
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 630 898 9.0E-32
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 627 876 9.0E-32
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 630 894 9.0E-32
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 624 895 9.0E-32
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 627 895 1.0E-31
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 630 883 1.0E-31
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 630 896 1.0E-31
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 627 878 1.0E-31
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 630 886 1.0E-31
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 630 894 1.0E-31
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 630 894 2.0E-31
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 622 895 2.0E-31
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 623 894 2.0E-31
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 607 894 2.0E-31
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 627 889 3.0E-31
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 630 890 3.0E-31
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 630 890 3.0E-31
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 674 884 3.0E-31
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 630 890 3.0E-31
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 630 894 3.0E-31
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 619 894 3.0E-31
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 629 838 3.0E-31
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 630 850 4.0E-31
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 617 894 4.0E-31
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 630 894 4.0E-31
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 630 894 4.0E-31
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 624 894 4.0E-31
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 623 876 5.0E-31
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 629 894 5.0E-31
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 630 883 5.0E-31
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 630 873 5.0E-31
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 630 850 6.0E-31
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 620 838 6.0E-31
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 630 884 6.0E-31
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 624 894 6.0E-31
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 604 894 7.0E-31
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 630 894 7.0E-31
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 630 894 7.0E-31
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 630 884 7.0E-31
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 630 888 7.0E-31
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 603 894 7.0E-31
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 630 850 7.0E-31
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 675 895 7.0E-31
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 630 884 7.0E-31
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 630 894 7.0E-31
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 624 894 7.0E-31
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 630 888 9.0E-31
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 630 888 9.0E-31
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 630 867 9.0E-31
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 624 894 1.0E-30
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 630 895 1.0E-30
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 622 891 1.0E-30
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 630 894 1.0E-30
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 630 888 1.0E-30
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 630 888 1.0E-30
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 630 888 1.0E-30
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 615 894 1.0E-30
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 630 894 1.0E-30
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 630 895 1.0E-30
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 627 873 1.0E-30
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 630 894 1.0E-30
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 630 883 1.0E-30
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 630 859 1.0E-30
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 630 895 1.0E-30
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 630 895 1.0E-30
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 630 895 1.0E-30
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 583 888 1.0E-30
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 623 894 1.0E-30
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 617 894 1.0E-30
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 630 894 2.0E-30
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 624 889 2.0E-30
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 630 894 2.0E-30
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 630 895 2.0E-30
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 623 894 2.0E-30
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 630 889 2.0E-30
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 630 864 2.0E-30
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 674 884 2.0E-30
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 618 885 2.0E-30
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 630 884 2.0E-30
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 623 894 2.0E-30
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 630 894 2.0E-30
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 623 894 2.0E-30
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 623 849 2.0E-30
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 627 894 3.0E-30
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 630 888 3.0E-30
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 627 889 3.0E-30
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 622 896 3.0E-30
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 630 873 3.0E-30
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 630 895 3.0E-30
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 630 884 3.0E-30
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 603 894 3.0E-30
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 629 894 3.0E-30
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 630 882 4.0E-30
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 630 888 4.0E-30
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 617 894 4.0E-30
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 617 894 4.0E-30
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 630 894 5.0E-30
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 630 898 5.0E-30
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 624 895 5.0E-30
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 629 838 6.0E-30
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 667 889 6.0E-30
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 629 838 6.0E-30
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 627 894 6.0E-30
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 630 856 6.0E-30
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 630 894 7.0E-30
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 630 889 7.0E-30
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 630 893 7.0E-30
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 629 894 7.0E-30
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 629 876 7.0E-30
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 602 838 7.0E-30
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 630 893 8.0E-30
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 623 876 8.0E-30
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 620 838 8.0E-30
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 630 850 8.0E-30
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 630 850 9.0E-30
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 630 894 9.0E-30
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 622 894 9.0E-30
sp|Q54H45|DRKB_DICDI Probable serine/threonine-protein kinase drkB OS=Dictyostelium discoideum GN=drkB PE=3 SV=1 616 889 1.0E-29
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 623 854 1.0E-29
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 630 894 1.0E-29
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 624 895 1.0E-29
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 630 897 1.0E-29
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 629 894 1.0E-29
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 601 848 1.0E-29
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 630 898 1.0E-29
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 629 894 1.0E-29
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 630 894 1.0E-29
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 630 894 1.0E-29
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 623 849 1.0E-29
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 632 895 1.0E-29
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 622 871 1.0E-29
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 630 889 1.0E-29
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 630 894 1.0E-29
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 619 838 1.0E-29
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 603 894 1.0E-29
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 630 893 1.0E-29
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 623 876 1.0E-29
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 620 838 1.0E-29
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 630 897 1.0E-29
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 622 898 2.0E-29
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 630 872 2.0E-29
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 623 894 2.0E-29
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 630 894 2.0E-29
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 617 876 2.0E-29
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 588 894 2.0E-29
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 629 894 2.0E-29
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 673 889 2.0E-29
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 630 872 2.0E-29
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 617 895 2.0E-29
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 623 894 2.0E-29
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 615 897 2.0E-29
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 622 894 2.0E-29
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 628 888 2.0E-29
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 622 888 2.0E-29
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 630 852 2.0E-29
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 620 894 2.0E-29
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 629 876 3.0E-29
sp|P31938|MP2K1_MOUSE Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus GN=Map2k1 PE=1 SV=2 572 848 3.0E-29
sp|Q01986|MP2K1_RAT Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus GN=Map2k1 PE=1 SV=2 572 848 3.0E-29
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 630 878 3.0E-29
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 630 884 3.0E-29
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 630 884 3.0E-29
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 629 889 3.0E-29
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 630 888 3.0E-29
sp|Q91447|MP2K1_SERCA Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) OS=Serinus canaria GN=MAP2K1 PE=2 SV=1 572 848 3.0E-29
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 627 894 4.0E-29
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 629 894 4.0E-29
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 623 840 4.0E-29
sp|P29678|MP2K1_RABIT Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus GN=MAP2K1 PE=1 SV=2 572 848 4.0E-29
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 617 894 4.0E-29
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 630 894 4.0E-29
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 624 891 4.0E-29
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 627 894 4.0E-29
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 630 889 4.0E-29
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 630 876 4.0E-29
sp|Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens GN=MAP2K1 PE=1 SV=2 572 848 5.0E-29
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 630 889 5.0E-29
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 630 894 5.0E-29
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 629 838 5.0E-29
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 623 841 5.0E-29
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 617 876 5.0E-29
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 615 876 6.0E-29
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 627 895 6.0E-29
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 629 895 6.0E-29
sp|Q05116|MP2K1_XENLA Dual specificity mitogen-activated protein kinase kinase 1 OS=Xenopus laevis GN=map2k1 PE=1 SV=2 585 848 6.0E-29
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 617 897 6.0E-29
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 630 878 6.0E-29
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 629 894 6.0E-29
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 623 861 7.0E-29
sp|Q8TGI1|ATG1_PICPA Serine/threonine-protein kinase ATG1 OS=Komagataella pastoris GN=ATG1 PE=3 SV=1 624 863 7.0E-29
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 630 898 7.0E-29
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 629 876 7.0E-29
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 629 876 7.0E-29
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 627 894 7.0E-29
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 622 894 7.0E-29
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 630 896 8.0E-29
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 629 876 8.0E-29
sp|Q54H46|DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum GN=drkA PE=3 SV=1 616 889 8.0E-29
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 630 896 8.0E-29
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 629 889 9.0E-29
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 630 895 9.0E-29
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 630 838 9.0E-29
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 629 886 9.0E-29
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 630 889 9.0E-29
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 630 895 1.0E-28
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 630 838 1.0E-28
sp|Q7RX99|ATG1_NEUCR Serine/threonine-protein kinase apg-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-1 PE=3 SV=2 630 894 1.0E-28
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 630 838 1.0E-28
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 630 878 1.0E-28
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 627 895 1.0E-28
sp|Q9FX43|M2K9_ARATH Mitogen-activated protein kinase kinase 9 OS=Arabidopsis thaliana GN=MKK9 PE=1 SV=1 629 894 1.0E-28
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 630 896 1.0E-28
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 630 894 1.0E-28
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 594 894 1.0E-28
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 617 889 1.0E-28
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 624 894 1.0E-28
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 630 891 1.0E-28
sp|P36507|MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens GN=MAP2K2 PE=1 SV=1 594 848 1.0E-28
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 623 861 1.0E-28
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 630 878 2.0E-28
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 624 878 2.0E-28
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 629 854 2.0E-28
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 630 878 2.0E-28
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 630 854 2.0E-28
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 623 893 2.0E-28
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 630 896 2.0E-28
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 630 878 2.0E-28
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 623 893 2.0E-28
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 630 897 2.0E-28
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 629 894 2.0E-28
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 630 857 2.0E-28
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 624 850 2.0E-28
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 624 894 2.0E-28
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 630 861 2.0E-28
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 629 894 2.0E-28
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 629 895 2.0E-28
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 629 873 2.0E-28
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 629 867 2.0E-28
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 629 894 2.0E-28
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 629 850 2.0E-28
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 600 881 2.0E-28
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 615 888 2.0E-28
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 615 894 2.0E-28
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 629 873 2.0E-28
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 629 873 2.0E-28
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 629 873 2.0E-28
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 624 858 2.0E-28
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 623 894 3.0E-28
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 624 894 3.0E-28
sp|Q9SCU5|WNK5_ARATH Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2 629 895 3.0E-28
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 629 873 3.0E-28
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 623 857 3.0E-28
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 630 895 3.0E-28
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 629 838 3.0E-28
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 629 889 3.0E-28
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 623 893 3.0E-28
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 616 838 3.0E-28
sp|Q63980|MP2K1_CRIGR Dual specificity mitogen-activated protein kinase kinase 1 OS=Cricetulus griseus GN=MAP2K1 PE=1 SV=1 610 848 3.0E-28
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 624 888 4.0E-28
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 630 852 4.0E-28
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 630 885 2.0E-20
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 630 895 6.0E-20
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 630 895 6.0E-20
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 630 895 8.0E-19
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 630 895 4.0E-18
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 630 895 1.0E-17
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 630 894 2.0E-17
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 630 838 1.0E-16
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 630 894 1.0E-16
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 630 854 7.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0007165 signal transduction Yes
GO:0004672 protein kinase activity Yes
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:1901265 nucleoside phosphate binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043412 macromolecule modification No
GO:0030554 adenyl nucleotide binding No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0019538 protein metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0050789 regulation of biological process No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044237 cellular metabolic process No
GO:0016310 phosphorylation No
GO:0003674 molecular_function No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0016301 kinase activity No
GO:0043168 anion binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0065007 biological regulation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6653 0.2104 0.0541 0.3401 0.0757 0.0042 0.1236 0.1857 0.1264 0.0014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1032
Ophiocordyceps australis map64 (Brazil) OphauB2|6577
Ophiocordyceps camponoti-floridani Ophcf2|01913
Ophiocordyceps camponoti-rufipedis Ophun1|1104
Ophiocordyceps kimflemingae Ophio5|1777
Ophiocordyceps subramaniannii Hirsu2|2179 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2179
MAMLASKTTPFSATLSSSTMVSSSAPPSSAMPTTARRVPPSAPGAQTYPSPTESDFSDADADTSDSVKHWDEDRV
GEYLTSIGCGDYEKIFKKNHINGENLLELDKEVLREMGIDKVGDRVRLFLGIKRLRTRAYANQKKRNRDSFAGLE
IHSAPLLSESVRQSNARTAPLNKRYSRQIDLSVLDSGRQQRFAAGSGFMGGAPPSRLPASSSDAAAGRLAASHTR
NNSSMDGSLMAALPQNQDVIRVISTGGVTKVVKIAGCSTCEDVMRVTLRKFALREDHDRNYCFWVLTGIDPDPTQ
CRRLGDTELWRIIKDQRRPERNRLILRRVPAAEPGDAELQRAAAIALEEEQQKHAKALESVDKRSQLKVQKVLGE
KWNDQLQQPLSPISFQDRERTVSQAAKDLERPLTSDSSSRKPQRRKIGLRQFGGLRPPSELIASDLTSYFPDHPR
EDIDRTARLSMRRSSRLSKVNSRLSVASSLSFASSFQDAPPIPTIADAWLNGSAHVAKVRPRDSHGRLPALYNRD
SIASSMLDTLQEESPSASSAAHEPDRKSYVSFTESGSDTAALSITDPDGHTTRTSFYGDTSVGSGSFQDLQQALT
DDGEEADEELQSFLAGESWDDNKWMKGALIGQGSFGSVYLALHAVTGELLAVKQVETPAPGANSQSDARKKSMID
ALKREISLLRELRHPNIVQYLGCSSSADKLNIFLEYVPGGSVQTMLNSYGALPEPLVRSFVRQILTGLSYLHNRD
IIHRDIKGANILVDNKGTIKISDFGISKKLEASNILSGATSNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLG
CLVVEMMTGNHPFPDCSQLQAIFKIGGGKAAPTVPEHASDEAQHFLRQTFEIDHNLRPSADDLMLSPFLAPIT*
Coding >Hirsu2|2179
ATGGCCATGCTCGCCTCCAAGACGACGCCCTTCTCGGCCACGCTCAGCTCCTCTACCATGGTCTCCAGCAGCGCG
CCGCCCTCGTCGGCCATGCCCACGACGGCCCGGAGGGTGCCCCCGTCCGCCCCCGGCGCGCAAACCTACCCCAGC
CCGACCGAGTCCGACTTCTCCGACGCCGACGCCGACACCTCCGACTCCGTCAAGCACTGGGACGAGGACCGCGTC
GGCGAGTACCTGACCAGCATCGGCTGCGGCGACTACGAGAAGATCTTCAAGAAGAACCACATCAACGGCGAGAAC
CTGCTCGAGCTTGACAAGGAGGTGCTCCGCGAGATGGGCATCGACAAGGTCGGCGACCGCGTTCGCCTCTTCCTC
GGCATTAAGAGGCTGAGGACGAGGGCCTACGCCAACCAGAAGAAGCGTAACAGGGATTCCTTTGCCGGCCTCGAG
ATACATTCCGCGCCGCTCTTGAGCGAATCCGTCAGGCAGTCCAACGCGCGTACCGCGCCCCTGAACAAGCGATAC
TCGCGCCAGATTGATCTTTCTGTCCTTGATTCCGGTCGGCAACAACGATTTGCGGCCGGCTCCGGCTTCATGGGC
GGCGCCCCGCCGTCCCGACTGCCCGCCTCATCCTCGGACGCCGCCGCCGGACGCCTGGCGGCGTCGCACACGAGG
AACAACTCGAGCATGGACGGCTCGCTGATGGCGGCGCTGCCGCAGAACCAGGACGTCATTCGCGTCATCTCGACC
GGCGGCGTCACCAAGGTCGTCAAGATCGCCGGCTGCAGCACCTGCGAGGACGTGATGCGCGTGACGCTGCGAAAG
TTTGCCCTGCGCGAGGACCACGACCGCAACTACTGCTTCTGGGTCCTGACCGGCATCGACCCCGACCCGACTCAG
TGCCGCCGCCTGGGCGACACGGAGCTCTGGCGCATCATCAAGGACCAGCGCCGCCCGGAGCGGAACCGGCTGATC
CTGAGGCGGGTCCCCGCCGCCGAGCCCGGCGACGCCGAGCTGCAGCGCGCCGCGGCCATCGCGCTCGAGGAGGAG
CAGCAGAAGCACGCCAAGGCGCTCGAGTCGGTCGACAAGCGGAGCCAGCTCAAGGTGCAGAAGGTGCTGGGCGAG
AAGTGGAACGACCAGCTGCAGCAGCCGCTGTCGCCCATCTCCTTCCAGGACCGGGAGCGCACCGTGTCGCAGGCG
GCCAAGGACCTGGAGCGGCCGCTGACGAGCGACTCGTCGTCGCGCAAGCCGCAGCGGCGCAAGATCGGCCTCCGC
CAGTTCGGCGGCCTGCGCCCGCCGAGCGAGCTCATCGCGTCGGACCTGACGTCGTACTTCCCCGACCACCCGCGC
GAGGACATCGACCGGACGGCCCGGCTGTCGATGCGGCGGTCGTCGCGCCTCAGCAAGGTCAACAGCCGGCTCAGC
GTGGCCAGCAGCCTCAGCTTCGCCTCGAGCTTCCAGGACGCGCCGCCGATCCCGACGATTGCGGACGCGTGGCTC
AACGGCAGCGCGCACGTGGCCAAGGTGCGGCCGCGCGACTCGCACGGCCGCCTGCCGGCCCTGTACAACCGGGAC
TCGATCGCGTCGTCGATGCTGGACACGCTGCAGGAGGAGTCGCCGTCGGCGTCGTCGGCGGCGCACGAGCCGGAC
CGGAAGTCGTACGTCTCCTTCACCGAGAGCGGCTCGGACACGGCGGCGCTGAGCATCACGGACCCGGACGGGCAC
ACGACGCGGACCAGCTTCTACGGCGACACGTCGGTCGGGTCCGGCTCCTTCCAGGACCTGCAGCAGGCGCTGACG
GACGACGGCGAGGAGGCGGACGAGGAGCTGCAGAGCTTCCTGGCGGGCGAGTCGTGGGACGACAACAAGTGGATG
AAGGGCGCGCTCATCGGGCAGGGCTCGTTCGGGTCCGTCTACCTGGCGCTGCACGCCGTCACGGGCGAGCTGCTG
GCGGTCAAGCAGGTGGAGACGCCGGCGCCGGGGGCCAACAGCCAGAGCGACGCGCGCAAGAAGAGCATGATCGAC
GCGCTCAAGCGCGAGATCAGCCTGCTGCGGGAGCTGCGGCACCCCAACATCGTGCAGTACCTGGGCTGCAGCTCG
TCGGCCGACAAGCTCAACATCTTCCTCGAGTACGTGCCGGGCGGGTCGGTGCAGACGATGCTCAACTCGTACGGC
GCGCTGCCGGAGCCGCTGGTGCGCAGCTTCGTGCGGCAGATCTTGACGGGGCTGTCGTACCTGCACAACCGCGAC
ATCATCCACCGCGACATCAAGGGGGCCAACATCCTGGTCGACAACAAGGGCACCATCAAGATCTCCGACTTTGGC
ATCTCCAAGAAGCTCGAGGCGTCCAACATCCTGAGCGGGGCGACGAGCAACAAGCACCGGCCCTCGCTGCAGGGC
TCCGTCTTCTGGATGGCGCCCGAGGTGGTGAAGCAGACGTCGTACACGCGCAAGGCCGACATCTGGTCGCTCGGC
TGCCTGGTGGTGGAGATGATGACGGGCAACCACCCGTTCCCGGACTGCAGCCAGCTGCAGGCCATCTTCAAGATC
GGCGGCGGCAAGGCGGCGCCGACGGTGCCGGAGCACGCCAGCGACGAGGCCCAGCACTTTCTGCGGCAGACGTTT
GAGATCGACCACAACCTGCGGCCCAGCGCCGACGACCTGATGCTGAGCCCCTTTCTGGCGCCCATAACCTGA
Transcript >Hirsu2|2179
ATGGCCATGCTCGCCTCCAAGACGACGCCCTTCTCGGCCACGCTCAGCTCCTCTACCATGGTCTCCAGCAGCGCG
CCGCCCTCGTCGGCCATGCCCACGACGGCCCGGAGGGTGCCCCCGTCCGCCCCCGGCGCGCAAACCTACCCCAGC
CCGACCGAGTCCGACTTCTCCGACGCCGACGCCGACACCTCCGACTCCGTCAAGCACTGGGACGAGGACCGCGTC
GGCGAGTACCTGACCAGCATCGGCTGCGGCGACTACGAGAAGATCTTCAAGAAGAACCACATCAACGGCGAGAAC
CTGCTCGAGCTTGACAAGGAGGTGCTCCGCGAGATGGGCATCGACAAGGTCGGCGACCGCGTTCGCCTCTTCCTC
GGCATTAAGAGGCTGAGGACGAGGGCCTACGCCAACCAGAAGAAGCGTAACAGGGATTCCTTTGCCGGCCTCGAG
ATACATTCCGCGCCGCTCTTGAGCGAATCCGTCAGGCAGTCCAACGCGCGTACCGCGCCCCTGAACAAGCGATAC
TCGCGCCAGATTGATCTTTCTGTCCTTGATTCCGGTCGGCAACAACGATTTGCGGCCGGCTCCGGCTTCATGGGC
GGCGCCCCGCCGTCCCGACTGCCCGCCTCATCCTCGGACGCCGCCGCCGGACGCCTGGCGGCGTCGCACACGAGG
AACAACTCGAGCATGGACGGCTCGCTGATGGCGGCGCTGCCGCAGAACCAGGACGTCATTCGCGTCATCTCGACC
GGCGGCGTCACCAAGGTCGTCAAGATCGCCGGCTGCAGCACCTGCGAGGACGTGATGCGCGTGACGCTGCGAAAG
TTTGCCCTGCGCGAGGACCACGACCGCAACTACTGCTTCTGGGTCCTGACCGGCATCGACCCCGACCCGACTCAG
TGCCGCCGCCTGGGCGACACGGAGCTCTGGCGCATCATCAAGGACCAGCGCCGCCCGGAGCGGAACCGGCTGATC
CTGAGGCGGGTCCCCGCCGCCGAGCCCGGCGACGCCGAGCTGCAGCGCGCCGCGGCCATCGCGCTCGAGGAGGAG
CAGCAGAAGCACGCCAAGGCGCTCGAGTCGGTCGACAAGCGGAGCCAGCTCAAGGTGCAGAAGGTGCTGGGCGAG
AAGTGGAACGACCAGCTGCAGCAGCCGCTGTCGCCCATCTCCTTCCAGGACCGGGAGCGCACCGTGTCGCAGGCG
GCCAAGGACCTGGAGCGGCCGCTGACGAGCGACTCGTCGTCGCGCAAGCCGCAGCGGCGCAAGATCGGCCTCCGC
CAGTTCGGCGGCCTGCGCCCGCCGAGCGAGCTCATCGCGTCGGACCTGACGTCGTACTTCCCCGACCACCCGCGC
GAGGACATCGACCGGACGGCCCGGCTGTCGATGCGGCGGTCGTCGCGCCTCAGCAAGGTCAACAGCCGGCTCAGC
GTGGCCAGCAGCCTCAGCTTCGCCTCGAGCTTCCAGGACGCGCCGCCGATCCCGACGATTGCGGACGCGTGGCTC
AACGGCAGCGCGCACGTGGCCAAGGTGCGGCCGCGCGACTCGCACGGCCGCCTGCCGGCCCTGTACAACCGGGAC
TCGATCGCGTCGTCGATGCTGGACACGCTGCAGGAGGAGTCGCCGTCGGCGTCGTCGGCGGCGCACGAGCCGGAC
CGGAAGTCGTACGTCTCCTTCACCGAGAGCGGCTCGGACACGGCGGCGCTGAGCATCACGGACCCGGACGGGCAC
ACGACGCGGACCAGCTTCTACGGCGACACGTCGGTCGGGTCCGGCTCCTTCCAGGACCTGCAGCAGGCGCTGACG
GACGACGGCGAGGAGGCGGACGAGGAGCTGCAGAGCTTCCTGGCGGGCGAGTCGTGGGACGACAACAAGTGGATG
AAGGGCGCGCTCATCGGGCAGGGCTCGTTCGGGTCCGTCTACCTGGCGCTGCACGCCGTCACGGGCGAGCTGCTG
GCGGTCAAGCAGGTGGAGACGCCGGCGCCGGGGGCCAACAGCCAGAGCGACGCGCGCAAGAAGAGCATGATCGAC
GCGCTCAAGCGCGAGATCAGCCTGCTGCGGGAGCTGCGGCACCCCAACATCGTGCAGTACCTGGGCTGCAGCTCG
TCGGCCGACAAGCTCAACATCTTCCTCGAGTACGTGCCGGGCGGGTCGGTGCAGACGATGCTCAACTCGTACGGC
GCGCTGCCGGAGCCGCTGGTGCGCAGCTTCGTGCGGCAGATCTTGACGGGGCTGTCGTACCTGCACAACCGCGAC
ATCATCCACCGCGACATCAAGGGGGCCAACATCCTGGTCGACAACAAGGGCACCATCAAGATCTCCGACTTTGGC
ATCTCCAAGAAGCTCGAGGCGTCCAACATCCTGAGCGGGGCGACGAGCAACAAGCACCGGCCCTCGCTGCAGGGC
TCCGTCTTCTGGATGGCGCCCGAGGTGGTGAAGCAGACGTCGTACACGCGCAAGGCCGACATCTGGTCGCTCGGC
TGCCTGGTGGTGGAGATGATGACGGGCAACCACCCGTTCCCGGACTGCAGCCAGCTGCAGGCCATCTTCAAGATC
GGCGGCGGCAAGGCGGCGCCGACGGTGCCGGAGCACGCCAGCGACGAGGCCCAGCACTTTCTGCGGCAGACGTTT
GAGATCGACCACAACCTGCGGCCCAGCGCCGACGACCTGATGCTGAGCCCCTTTCTGGCGCCCATAACCTGA
Gene >Hirsu2|2179
ATGGCCATGCTCGCCTCCAAGACGACGCCCTTCTCGGCCACGCTCAGCTCCTCTACCATGGTCTCCAGCAGCGCG
CCGCCCTCGTCGGCCATGCCCACGACGGCCCGGAGGGTGCCCCCGTCCGCCCCCGGCGCGCAAACCTACCCCAGC
CCGACCGAGTCCGACTTCTCCGACGCCGACGCCGACACCTCCGACTCCGTCAAGCACTGGGACGAGGACCGCGTC
GGCGAGTACCTGACCAGCATCGGCTGCGGCGACTACGAGAAGATCTTCAAGAAGAACCACATCAACGGCGAGAAC
CTGCTCGAGCTTGACAAGGAGGTGCTCCGCGAGATGGGCATCGACAAGGTCGGCGACCGCGTTCGCCTCTTCCTC
GGCATTAAGAGGCTGAGGACGAGGGCCTACGCCAACCAGAAGAAGCGTAACAGGGTCAGTTTGTCCCTGCCGACC
GTGTGGCGTACCTTGCCCTCGCTGACGGGACATGTTGTAGGATTCCTTTGCCGGCCTCGAGATACATTCCGCGCC
GCTCTTGAGCGAATCCGTCAGGCAGTCCAACGCGCGTACCGCGCCCCTGAACAAGCGATACTCGCGCCAGATTGA
TCTTTCTGTCCTTGATTCCGGTACGCTCTTCTCTCCCCACTGCCTGCAGCCTCTCCCCCCACAGGGTGCTTCTGC
TGACGTCCCCGCGCCACCCACCCAGGTCGGCAACAACGATTTGCGGCCGGCTCCGGCTTCATGGGCGGCGCCCCG
CCGTCCCGACTGCCCGCCTCATCCTCGGACGCCGCCGCCGGACGCCTGGCGGCGTCGCACACGAGGAACAACTCG
AGCATGGACGGCTCGCTGATGGCGGCGCTGCCGCAGAACCAGGACGTCATTCGCGTCATCTCGACCGGCGGCGTC
ACCAAGGTCGTCAAGATCGCCGGCTGCAGCACCTGCGAGGACGTGATGCGCGTGACGCTGCGAAAGTTTGCCCTG
CGCGAGGACCACGACCGCAACTACTGCTTCTGGGTCCTGACCGGCATCGACCCCGACCCGACTCAGTGCCGCCGC
CTGGGCGACACGGAGCTCTGGCGCATCATCAAGGACCAGCGCCGCCCGGAGCGGAACCGGCTGATCCTGAGGCGG
GTCCCCGCCGCCGAGCCCGGCGACGCCGAGCTGCAGCGCGCCGCGGCCATCGCGCTCGAGGAGGAGCAGCAGAAG
CACGCCAAGGCGCTCGAGTCGGTCGACAAGCGGAGCCAGCTCAAGGTGCAGAAGGTGCTGGGCGAGAAGTGGAAC
GACCAGCTGCAGCAGCCGCTGTCGCCCATCTCCTTCCAGGACCGGGAGCGCACCGTGTCGCAGGCGGCCAAGGAC
CTGGAGCGGCCGCTGACGAGCGACTCGTCGTCGCGCAAGCCGCAGCGGCGCAAGATCGGCCTCCGCCAGTTCGGC
GGCCTGCGCCCGCCGAGCGAGCTCATCGCGTCGGACCTGACGTCGTACTTCCCCGACCACCCGCGCGAGGACATC
GACCGGACGGCCCGGCTGTCGATGCGGCGGTCGTCGCGCCTCAGCAAGGTCAACAGCCGGCTCAGCGTGGCCAGC
AGCCTCAGCTTCGCCTCGAGCTTCCAGGACGCGCCGCCGATCCCGACGATTGCGGACGCGTGGCTCAACGGCAGC
GCGCACGTGGCCAAGGTGCGGCCGCGCGACTCGCACGGCCGCCTGCCGGCCCTGTACAACCGGGACTCGATCGCG
TCGTCGATGCTGGACACGCTGCAGGAGGAGTCGCCGTCGGCGTCGTCGGCGGCGCACGAGCCGGACCGGAAGTCG
TACGTCTCCTTCACCGAGAGCGGCTCGGACACGGCGGCGCTGAGCATCACGGACCCGGACGGGCACACGACGCGG
ACCAGCTTCTACGGCGACACGTCGGTCGGGTCCGGCTCCTTCCAGGACCTGCAGCAGGCGCTGACGGACGACGGC
GAGGAGGCGGACGAGGAGCTGCAGAGCTTCCTGGCGGGCGAGTCGTGGGACGACAACAAGTGGATGAAGGGCGCG
CTCATCGGGCAGGGCTCGTTCGGGTCCGTCTACCTGGCGCTGCACGCCGTCACGGGCGAGCTGCTGGCGGTCAAG
CAGGTGGAGACGCCGGCGCCGGGGGCCAACAGCCAGAGCGACGCGCGCAAGAAGAGCATGATCGACGCGCTCAAG
CGCGAGATCAGCCTGCTGCGGGAGCTGCGGCACCCCAACATCGTGCAGTACCTGGGCTGCAGCTCGTCGGCCGAC
AAGCTCAACATCTTCCTCGAGTACGTGCCGGGCGGGTCGGTGCAGACGATGCTCAACTCGTACGGCGCGCTGCCG
GAGCCGCTGGTGCGCAGCTTCGTGCGGCAGATCTTGACGGGGCTGTCGTACCTGCACAACCGCGACATCATCCAC
CGCGACATCAAGGGGGCCAACATCCTGGTCGACAACAAGGGCACCATCAAGATCTCCGACTTTGGCATCTCCAAG
AAGCTCGAGGCGTCCAACATCCTGAGCGGGGCGACGAGCAACAAGCACCGGCCCTCGCTGCAGGGCTCCGTCTTC
TGGATGGCGCCCGAGGTGGTGAAGCAGACGTCGTACACGCGCAAGGCCGACATCTGGTCGCTCGGCTGCCTGGTG
GTGGAGATGATGACGGGCAACCACCCGTTCCCGGACTGCAGCCAGCTGCAGGCCATCTTCAAGATCGGCGGCGGC
AAGGCGGCGCCGACGGTGCCGGAGCACGCCAGCGACGAGGCCCAGCACTTTCTGCGGCAGACGTTTGAGATCGAC
CACAACCTGCGGCCCAGCGCCGACGACCTGATGCTGAGCCCCTTTCTGGCGCCCATAACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail