Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2167
Gene name
LocationContig_150:30902..32486
Strand-
Gene length (bp)1584
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.8E-12 10 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 51 475 7.0E-44
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 51 475 7.0E-44
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 51 435 2.0E-42
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 51 435 2.0E-42
sp|Q39085|DIM_ARATH Delta(24)-sterol reductase OS=Arabidopsis thaliana GN=DIM PE=1 SV=2 46 495 8.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 51 475 7.0E-44
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 51 475 7.0E-44
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 51 435 2.0E-42
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 51 435 2.0E-42
sp|Q39085|DIM_ARATH Delta(24)-sterol reductase OS=Arabidopsis thaliana GN=DIM PE=1 SV=2 46 495 8.0E-36
sp|O17397|DIML_CAEEL Diminuto-like protein OS=Caenorhabditis elegans GN=F52H2.6 PE=3 SV=1 37 435 4.0E-34
sp|P93472|DIM_PEA Delta(24)-sterol reductase OS=Pisum sativum GN=DIM PE=1 SV=1 46 498 9.0E-33
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 75 223 3.0E-11
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 75 232 2.0E-09
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 4 212 2.0E-09
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 73 224 4.0E-09
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 75 257 1.0E-08
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 11 175 2.0E-08
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 29 285 3.0E-08
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 45 167 1.0E-07
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 41 202 2.0E-07
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 7 210 4.0E-07
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 75 175 4.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 42 205 8.0E-07
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 75 175 9.0E-07
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 75 175 9.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 69 207 2.0E-06
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 41 202 2.0E-06
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 39 201 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0050662 coenzyme binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 143 165 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2167
MERHKEAVGKIAAAVRGFFERKESYRIFHGSTNSTRPRPRPGARVVDISALSNAIAVDRAARTALVEPNVPMDRL
VETTLREGLVPPVVMEFPGITAGGGYAGTAGESSSFRHGFFNDTVNYIEMVLGNGEVVRASRNDRADLFLGAAGA
VGTLGITTLLELRLVEAKKWIKTTYHRTGSVAEAVAKVRAETRDPTIDYVDGILFSKDHGAVITGRMTDDKPDHC
VPQTFSGAWDPWYYLHVQEQTATAAEATDYIPLNEYLFRYDRAGFWVGAQGWTYFKYVPFNRFFRWFLDDFMHTR
MLYRALHASGESARFVVQDLALPYDKAEQFVDYTADSFDIWPLWLCPLKQTLPPTFHPYTGETEETTAGPDGSDK
PLVVPKDVLNIGLWGWGPPDHDVFIAKNRALEDKLVQLGGRKWLYAHTYYSEEDFWRVYNDHGAIGQVKAGPGAN
STRAWYEALRTKYHATTLPTVYEKVRIDVDAAREERAKWRMSLKSRWPIGGLYGIWKSIQSGDYAHHRNAAWKYK
KD*
Coding >Hirsu2|2167
ATGGAGCGCCACAAGGAGGCCGTCGGCAAAATCGCCGCGGCCGTTCGCGGCTTCTTTGAGCGCAAGGAGTCATAC
CGCATCTTCCACGGTAGCACCAACAGCACCCGTCCGCGGCCGCGGCCCGGCGCGCGCGTCGTCGACATCAGCGCC
CTTTCTAACGCCATCGCCGTCGACCGCGCCGCCCGCACCGCCCTCGTCGAGCCCAACGTTCCTATGGACCGCCTA
GTCGAGACGACACTGCGCGAGGGCCTCGTGCCGCCCGTCGTTATGGAGTTCCCCGGCATTACAGCCGGCGGCGGC
TATGCGGGCACGGCTGGCGAGAGCTCGTCGTTCCGCCACGGCTTCTTTAACGATACGGTCAACTACATTGAGATG
GTCCTAGGCAACGGCGAGGTCGTCCGCGCCTCGCGTAATGACCGCGCCGACCTATTTCTCGGCGCCGCCGGCGCC
GTCGGGACACTTGGCATCACGACGCTGCTCGAGCTGCGCCTAGTCGAGGCCAAGAAGTGGATAAAGACGACGTAC
CACCGCACCGGCAGCGTGGCCGAGGCCGTGGCCAAGGTGCGCGCCGAGACGCGGGATCCGACCATCGACTACGTC
GATGGCATTCTCTTCTCCAAGGACCACGGTGCCGTCATCACCGGCCGCATGACCGACGACAAGCCCGACCATTGC
GTGCCCCAGACCTTCAGCGGAGCTTGGGATCCCTGGTACTATCTGCATGTCCAGGAGCAGACGGCGACGGCGGCC
GAGGCGACAGACTACATCCCGCTTAACGAGTACCTCTTTCGGTACGACCGCGCCGGCTTCTGGGTTGGTGCCCAG
GGCTGGACCTACTTCAAGTACGTTCCCTTTAACCGCTTCTTTCGCTGGTTCCTCGACGACTTCATGCACACGCGC
ATGCTCTACCGTGCGCTGCACGCCAGCGGCGAGTCTGCCCGCTTCGTCGTCCAGGACCTGGCCTTGCCGTACGAC
AAGGCCGAGCAGTTCGTCGACTACACAGCCGACAGTTTCGACATCTGGCCCCTCTGGCTGTGCCCCCTCAAACAG
ACGCTGCCCCCGACCTTTCACCCGTACACGGGCGAGACGGAGGAGACGACAGCCGGCCCCGACGGCTCGGACAAG
CCGTTGGTCGTGCCCAAGGATGTTCTCAACATCGGCCTCTGGGGATGGGGCCCACCGGACCACGACGTCTTCATC
GCCAAGAACCGCGCGCTCGAGGACAAGCTCGTCCAGCTGGGCGGTCGAAAGTGGCTGTACGCCCATACGTACTAC
TCCGAGGAAGACTTCTGGCGCGTCTACAACGACCACGGCGCCATCGGCCAGGTCAAAGCCGGGCCCGGCGCCAAT
AGCACCCGTGCTTGGTACGAGGCGCTGCGGACCAAGTACCACGCCACGACGCTGCCGACCGTCTACGAAAAGGTG
CGCATCGACGTCGACGCCGCCCGCGAGGAGCGCGCCAAGTGGCGCATGTCCCTCAAGAGCAGATGGCCCATCGGC
GGGCTCTACGGCATCTGGAAGAGCATACAGAGCGGCGACTACGCCCACCACCGCAACGCCGCGTGGAAGTACAAG
AAGGATTAG
Transcript >Hirsu2|2167
ATGGAGCGCCACAAGGAGGCCGTCGGCAAAATCGCCGCGGCCGTTCGCGGCTTCTTTGAGCGCAAGGAGTCATAC
CGCATCTTCCACGGTAGCACCAACAGCACCCGTCCGCGGCCGCGGCCCGGCGCGCGCGTCGTCGACATCAGCGCC
CTTTCTAACGCCATCGCCGTCGACCGCGCCGCCCGCACCGCCCTCGTCGAGCCCAACGTTCCTATGGACCGCCTA
GTCGAGACGACACTGCGCGAGGGCCTCGTGCCGCCCGTCGTTATGGAGTTCCCCGGCATTACAGCCGGCGGCGGC
TATGCGGGCACGGCTGGCGAGAGCTCGTCGTTCCGCCACGGCTTCTTTAACGATACGGTCAACTACATTGAGATG
GTCCTAGGCAACGGCGAGGTCGTCCGCGCCTCGCGTAATGACCGCGCCGACCTATTTCTCGGCGCCGCCGGCGCC
GTCGGGACACTTGGCATCACGACGCTGCTCGAGCTGCGCCTAGTCGAGGCCAAGAAGTGGATAAAGACGACGTAC
CACCGCACCGGCAGCGTGGCCGAGGCCGTGGCCAAGGTGCGCGCCGAGACGCGGGATCCGACCATCGACTACGTC
GATGGCATTCTCTTCTCCAAGGACCACGGTGCCGTCATCACCGGCCGCATGACCGACGACAAGCCCGACCATTGC
GTGCCCCAGACCTTCAGCGGAGCTTGGGATCCCTGGTACTATCTGCATGTCCAGGAGCAGACGGCGACGGCGGCC
GAGGCGACAGACTACATCCCGCTTAACGAGTACCTCTTTCGGTACGACCGCGCCGGCTTCTGGGTTGGTGCCCAG
GGCTGGACCTACTTCAAGTACGTTCCCTTTAACCGCTTCTTTCGCTGGTTCCTCGACGACTTCATGCACACGCGC
ATGCTCTACCGTGCGCTGCACGCCAGCGGCGAGTCTGCCCGCTTCGTCGTCCAGGACCTGGCCTTGCCGTACGAC
AAGGCCGAGCAGTTCGTCGACTACACAGCCGACAGTTTCGACATCTGGCCCCTCTGGCTGTGCCCCCTCAAACAG
ACGCTGCCCCCGACCTTTCACCCGTACACGGGCGAGACGGAGGAGACGACAGCCGGCCCCGACGGCTCGGACAAG
CCGTTGGTCGTGCCCAAGGATGTTCTCAACATCGGCCTCTGGGGATGGGGCCCACCGGACCACGACGTCTTCATC
GCCAAGAACCGCGCGCTCGAGGACAAGCTCGTCCAGCTGGGCGGTCGAAAGTGGCTGTACGCCCATACGTACTAC
TCCGAGGAAGACTTCTGGCGCGTCTACAACGACCACGGCGCCATCGGCCAGGTCAAAGCCGGGCCCGGCGCCAAT
AGCACCCGTGCTTGGTACGAGGCGCTGCGGACCAAGTACCACGCCACGACGCTGCCGACCGTCTACGAAAAGGTG
CGCATCGACGTCGACGCCGCCCGCGAGGAGCGCGCCAAGTGGCGCATGTCCCTCAAGAGCAGATGGCCCATCGGC
GGGCTCTACGGCATCTGGAAGAGCATACAGAGCGGCGACTACGCCCACCACCGCAACGCCGCGTGGAAGTACAAG
AAGGATTAG
Gene >Hirsu2|2167
ATGGAGCGCCACAAGGAGGCCGTCGGCAAAATCGCCGCGGCCGTTCGCGGCTTCTTTGAGCGCAAGGAGTCATAC
CGCATCTTCCACGGTAGCACCAACAGCACCCGTCCGCGGCCGCGGCCCGGCGCGCGCGTCGTCGACATCAGCGCC
CTTTCTAACGCCATCGCCGTCGACCGCGCCGCCCGCACCGCCCTCGTCGAGCCCAACGTTCCTATGGACCGCCTA
GTCGAGACGACACTGCGCGAGGGCCTCGTGCCGCCCGTCGTTATGGAGTTCCCCGGCATTACAGCCGGCGGCGGC
TATGCGGGCACGGCTGGCGAGAGCTCGTCGTTCCGCCACGGCTTCTTTAACGATACGGTCAACTACATTGAGATG
GTCCTAGGCAACGGCGAGGTCGTCCGCGCCTCGCGTAATGACCGCGCCGACCTATTTCTCGGCGCCGCCGGCGCC
GTCGGGACACTTGGCATCACGACGCTGCTCGAGCTGCGCCTAGTCGAGGCCAAGAAGTGGATAAAGACGACGTAC
CACCGCACCGGCAGCGTGGCCGAGGCCGTGGCCAAGGTGCGCGCCGAGACGCGGGATCCGACCATCGACTACGTC
GATGGCATTCTCTTCTCCAAGGACCACGGTGCCGTCATCACCGGCCGCATGACCGACGACAAGCCCGACCATTGC
GTGCCCCAGACCTTCAGCGGAGCTTGGGATCCCTGGTACTATCTGCATGTCCAGGAGCAGACGGCGACGGCGGCC
GAGGCGACAGACTACATCCCGCTTAACGAGTACCTCTTTCGGTACGACCGCGCCGGCTTCTGGGTTGGTGCCCAG
GGCTGGACCTACTTCAAGTACGTTCCCTTTAACCGCTTCTTTCGCTGGTTCCTCGACGACTTCATGCACACGCGC
ATGCTCTACCGTGCGCTGCACGCCAGCGGCGAGTCTGCCCGCTTCGTCGTCCAGGACCTGGCCTTGCCGTACGAC
AAGGCCGAGCAGTTCGTCGACTACACAGCCGACAGTTTCGACATCTGGCCCCTCTGGCTGTGCCCCCTCAAACAG
ACGCTGCCCCCGACCTTTCACCCGTACACGGGCGAGACGGAGGAGACGACAGCCGGCCCCGACGGCTCGGACAAG
CCGTTGGTCGTGCCCAAGGATGTTCTCAACATCGGCCTCTGGGGATGGGGCCCACCGGACCACGACGTCTTCATC
GCCAAGAACCGCGCGCTCGAGGACAAGCTCGTCCAGCTGGGCGGTCGAAAGTGGCTGTACGCCCATACGTACTAC
TCCGAGGAAGACTTCTGGCGCGTCTACAACGACCACGGCGCCATCGGCCAGGTCAAAGCCGGGCCCGGCGCCAAT
AGCACCCGTGCTTGGTACGAGGCGCTGCGGACCAAGTACCACGCCACGACGCTGCCGACCGTCTACGAAAAGGTG
CGCATCGACGTCGACGCCGCCCGCGAGGAGCGCGCCAAGTGGCGCATGTCCCTCAAGAGCAGATGGCCCATCGGC
GGGCTCTACGGCATCTGGAAGAGCATACAGAGCGGCGACTACGCCCACCACCGCAACGCCGCGTGGAAGTACAAG
AAGGATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail