Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2164
Gene name
LocationContig_150:20661..22053
Strand-
Gene length (bp)1392
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00022 Actin Actin 3.0E-102 6 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ1|ARP2_SCHPO Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 6 390 0.0E+00
sp|P32381|ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 6 390 0.0E+00
sp|P53487|ARP2_ACACA Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 7 386 0.0E+00
sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 7 388 0.0E+00
sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 7 388 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ1|ARP2_SCHPO Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 6 390 0.0E+00
sp|P32381|ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 6 390 0.0E+00
sp|P53487|ARP2_ACACA Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 7 386 0.0E+00
sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 7 388 0.0E+00
sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 7 388 0.0E+00
sp|Q7ZXV3|ARP2B_XENLA Actin-related protein 2-B OS=Xenopus laevis GN=actr2-b PE=2 SV=1 7 388 0.0E+00
sp|Q5M7U6|ARP2_RAT Actin-related protein 2 OS=Rattus norvegicus GN=Actr2 PE=2 SV=1 7 388 0.0E+00
sp|Q5R4K0|ARP2_PONAB Actin-related protein 2 OS=Pongo abelii GN=ACTR2 PE=2 SV=1 7 388 0.0E+00
sp|P61161|ARP2_MOUSE Actin-related protein 2 OS=Mus musculus GN=Actr2 PE=1 SV=1 7 388 0.0E+00
sp|P61160|ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens GN=ACTR2 PE=1 SV=1 7 388 0.0E+00
sp|A7MB62|ARP2_BOVIN Actin-related protein 2 OS=Bos taurus GN=ACTR2 PE=1 SV=1 7 388 0.0E+00
sp|Q5BL41|ARP2_XENTR Actin-related protein 2 OS=Xenopus tropicalis GN=actr2 PE=2 SV=1 7 388 0.0E+00
sp|Q7SXW6|ARP2A_DANRE Actin-related protein 2-A OS=Danio rerio GN=actr2a PE=2 SV=1 7 388 0.0E+00
sp|Q56A35|ARP2B_DANRE Actin-related protein 2-B OS=Danio rerio GN=actr2b PE=2 SV=1 7 388 0.0E+00
sp|P45888|ARP2_DROME Actin-related protein 2 OS=Drosophila melanogaster GN=Arp2 PE=2 SV=3 7 387 0.0E+00
sp|O96621|ARP2_DICDI Actin-related protein 2 OS=Dictyostelium discoideum GN=arpB PE=1 SV=1 1 387 0.0E+00
sp|P53489|ARP2_CAEEL Actin-related protein 2 OS=Caenorhabditis elegans GN=arx-2 PE=3 SV=1 7 388 0.0E+00
sp|Q61JZ2|ARP2_CAEBR Actin-related protein 2 OS=Caenorhabditis briggsae GN=arx-2 PE=3 SV=1 7 388 6.0E-178
sp|Q9LSD6|ARP2_ARATH Actin-related protein 2 OS=Arabidopsis thaliana GN=ARP2 PE=1 SV=1 1 387 1.0E-163
sp|Q6Z256|ARP2_ORYSJ Actin-related protein 2 OS=Oryza sativa subsp. japonica GN=ARP2 PE=3 SV=1 7 388 6.0E-162
sp|A2YUL5|ARP2_ORYSI Actin-related protein 2 OS=Oryza sativa subsp. indica GN=ARP2 PE=3 SV=2 7 388 1.0E-161
sp|P0C540|ACT7_ORYSJ Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE=3 SV=1 6 385 6.0E-121
sp|P0C542|ACT7_ORYSI Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3 SV=1 6 385 6.0E-121
sp|P53492|ACT7_ARATH Actin-7 OS=Arabidopsis thaliana GN=ACT7 PE=1 SV=1 6 386 2.0E-120
sp|P0CJ47|ACT3_ARATH Actin-3 OS=Arabidopsis thaliana GN=ACT3 PE=1 SV=1 6 386 8.0E-120
sp|P0CJ46|ACT1_ARATH Actin-1 OS=Arabidopsis thaliana GN=ACT1 PE=1 SV=1 6 386 8.0E-120
sp|P02578|ACT1_ACACA Actin-1 OS=Acanthamoeba castellanii PE=1 SV=1 7 386 1.0E-119
sp|Q10AZ4|ACT3_ORYSJ Actin-3 OS=Oryza sativa subsp. japonica GN=ACT3 PE=2 SV=1 6 386 3.0E-119
sp|A2XNS1|ACT3_ORYSI Actin-3 OS=Oryza sativa subsp. indica GN=ACT3 PE=3 SV=2 6 386 3.0E-119
sp|P53459|ACT6_DIPDE Actin-6 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT6 PE=2 SV=1 6 386 3.0E-119
sp|Q05214|ACT1_TOBAC Actin OS=Nicotiana tabacum PE=3 SV=1 6 386 4.0E-119
sp|O18499|ACT1_SACKO Actin-1 OS=Saccoglossus kowalevskii PE=2 SV=1 7 386 5.0E-119
sp|Q0PGG4|ACTB_BOSMU Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACTB PE=2 SV=1 7 386 5.0E-119
sp|A3C6D7|ACT2_ORYSJ Actin-2 OS=Oryza sativa subsp. japonica GN=ACT2 PE=2 SV=1 6 386 6.0E-119
sp|P0C539|ACT2_ORYSI Actin-2 OS=Oryza sativa subsp. indica GN=ACT2 PE=3 SV=1 6 386 6.0E-119
sp|P53458|ACT5_DIPDE Actin-5 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT5 PE=2 SV=1 7 386 7.0E-119
sp|P53485|ACTB2_TAKRU Actin, cytoplasmic 2 OS=Takifugu rubripes GN=actbb PE=3 SV=1 7 386 7.0E-119
sp|P10365|ACT_THELA Actin OS=Thermomyces lanuginosus PE=3 SV=1 7 386 7.0E-119
sp|O18500|ACT2_SACKO Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1 7 386 7.0E-119
sp|A2BDB0|ACTG_XENLA Actin, cytoplasmic 2 OS=Xenopus laevis GN=actg1 PE=2 SV=1 7 386 9.0E-119
sp|P63257|ACTG_TRIVU Actin, cytoplasmic 2 OS=Trichosurus vulpecula GN=ACTG1 PE=2 SV=1 7 386 9.0E-119
sp|P63259|ACTG_RAT Actin, cytoplasmic 2 OS=Rattus norvegicus GN=Actg1 PE=1 SV=1 7 386 9.0E-119
sp|P63260|ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus GN=Actg1 PE=1 SV=1 7 386 9.0E-119
sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens GN=ACTG1 PE=1 SV=1 7 386 9.0E-119
sp|Q5ZMQ2|ACTG_CHICK Actin, cytoplasmic 2 OS=Gallus gallus GN=ACTG1 PE=1 SV=1 7 386 9.0E-119
sp|P63258|ACTG_BOVIN Actin, cytoplasmic 2 OS=Bos taurus GN=ACTG1 PE=1 SV=1 7 386 9.0E-119
sp|P35432|ACT1_ECHGR Actin-1 OS=Echinococcus granulosus GN=ACTI PE=3 SV=1 6 386 9.0E-119
sp|P53505|ACT5_XENLA Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1 7 386 1.0E-118
sp|Q5JAK2|ACTG_PELLE Actin, cytoplasmic 2 OS=Pelophylax lessonae GN=actg1 PE=2 SV=1 7 386 1.0E-118
sp|P48975|ACTB_CRIGR Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB PE=3 SV=1 7 386 1.0E-118
sp|P15475|ACTB_XENBO Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb PE=3 SV=1 7 386 1.0E-118
sp|P11426|ACT_ENTHI Actin OS=Entamoeba histolytica PE=2 SV=1 7 386 1.0E-118
sp|P29751|ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus GN=ACTB PE=2 SV=1 7 386 1.0E-118
sp|P84336|ACTB_CAMDR Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1 7 386 1.0E-118
sp|Q8JJB8|ACTG_TRISC Actin, cytoplasmic 2 OS=Triakis scyllium GN=actg1 PE=2 SV=1 7 386 1.0E-118
sp|P60707|ACTB_TRIVU Actin, cytoplasmic 1 OS=Trichosurus vulpecula GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|Q4L0Y2|ACTB_SPECI Actin, cytoplasmic 1 OS=Spermophilus citellus GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60713|ACTB_SHEEP Actin, cytoplasmic 1 OS=Ovis aries GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60711|ACTB_RAT Actin, cytoplasmic 1 OS=Rattus norvegicus GN=Actb PE=1 SV=1 7 386 2.0E-118
sp|Q5R6G0|ACTB_PONAB Actin, cytoplasmic 1 OS=Pongo abelii GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|Q6QAQ1|ACTB_PIG Actin, cytoplasmic 1 OS=Sus scrofa GN=ACTB PE=1 SV=2 7 386 2.0E-118
sp|Q5R1X3|ACTB_PANTR Actin, cytoplasmic 1 OS=Pan troglodytes GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60710|ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus GN=Actb PE=1 SV=1 7 386 2.0E-118
sp|Q711N9|ACTB_MESAU Actin, cytoplasmic 1 OS=Mesocricetus auratus GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|Q4R561|ACTB_MACFA Actin, cytoplasmic 1 OS=Macaca fascicularis GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|P60708|ACTB_HORSE Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|Q76N69|ACTB_CHLAE Actin, cytoplasmic 1 OS=Chlorocebus aethiops GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60706|ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|Q71FK5|ACTB_CAVPO Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|O18840|ACTB_CANLF Actin, cytoplasmic 1 OS=Canis lupus familiaris GN=ACTB PE=2 SV=3 7 386 2.0E-118
sp|P60712|ACTB_BOVIN Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|Q6P378|ACTG_XENTR Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg1 PE=2 SV=1 7 386 2.0E-118
sp|Q7ZVI7|ACTB1_DANRE Actin, cytoplasmic 1 OS=Danio rerio GN=actba PE=2 SV=2 7 386 2.0E-118
sp|P83750|ACTB_CYPCA Actin, cytoplasmic 1 OS=Cyprinus carpio GN=actb PE=3 SV=1 7 386 2.0E-118
sp|P83751|ACTB_CTEID Actin, cytoplasmic 1 OS=Ctenopharyngodon idella GN=actb PE=3 SV=1 7 386 2.0E-118
sp|Q7ZVF9|ACTB2_DANRE Actin, cytoplasmic 2 OS=Danio rerio GN=actbb PE=2 SV=2 7 386 2.0E-118
sp|O65315|ACT_COLSC Actin OS=Coleochaete scutata PE=2 SV=1 7 386 3.0E-118
sp|P30167|ACT3_SOLTU Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1 6 386 3.0E-118
sp|P53478|ACT5_CHICK Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV=1 7 386 3.0E-118
sp|P53470|ACT1_SCHMA Actin-1 OS=Schistosoma mansoni PE=2 SV=1 7 386 3.0E-118
sp|P30163|ACT2_ONCVO Actin-2 OS=Onchocerca volvulus GN=act-2b PE=3 SV=1 7 386 3.0E-118
sp|P53472|ACTA_STRPU Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus GN=CYIA PE=3 SV=1 7 386 3.0E-118
sp|P30171|ACT11_SOLTU Actin-97 OS=Solanum tuberosum GN=AC97 PE=3 SV=1 6 386 4.0E-118
sp|P10986|ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=3 SV=2 7 386 4.0E-118
sp|P45886|ACT3_BACDO Actin-3, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 7 386 4.0E-118
sp|P53467|ACTM_MOLOC Actin, larval muscle-type OS=Molgula oculata PE=3 SV=1 7 386 4.0E-118
sp|P07837|ACT2_BOMMO Actin, muscle-type A2 OS=Bombyx mori PE=3 SV=1 7 386 4.0E-118
sp|P69005|ACTD_STRPU Actin, cytoskeletal 2B OS=Strongylocentrotus purpuratus GN=CYIIB PE=2 SV=1 7 386 4.0E-118
sp|P69004|ACT2_STRFN Actin-15B OS=Strongylocentrotus franciscanus PE=2 SV=1 7 386 4.0E-118
sp|P10984|ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 7 386 4.0E-118
sp|P30162|ACT1_ONCVO Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1 7 386 4.0E-118
sp|O81221|ACT_GOSHI Actin OS=Gossypium hirsutum PE=3 SV=1 6 386 5.0E-118
sp|P69003|ACT1_HELTB Actin CyI, cytoplasmic OS=Heliocidaris tuberculata PE=3 SV=1 7 386 5.0E-118
sp|P69002|ACT1_HELER Actin CyI, cytoplasmic OS=Heliocidaris erythrogramma PE=3 SV=1 7 386 5.0E-118
sp|P45885|ACT2_BACDO Actin-2, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 7 386 5.0E-118
sp|Q6NVA9|ACTB_XENTR Actin, cytoplasmic 1 OS=Xenopus tropicalis GN=actb PE=2 SV=1 7 386 5.0E-118
sp|O93400|ACTB_XENLA Actin, cytoplasmic 1 OS=Xenopus laevis GN=actb PE=2 SV=1 7 386 5.0E-118
sp|P18603|ACT4_ARTSX Actin, clone 403 OS=Artemia sp. PE=2 SV=1 7 386 5.0E-118
sp|P30173|ACT13_SOLTU Actin-101 OS=Solanum tuberosum GN=AC101 PE=3 SV=1 6 386 5.0E-118
sp|O42161|ACTB_SALSA Actin, cytoplasmic 1 OS=Salmo salar GN=actb PE=2 SV=1 7 386 6.0E-118
sp|P53473|ACTB_STRPU Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus GN=CYIB PE=3 SV=1 7 386 6.0E-118
sp|P49128|ACT1_AEDAE Actin-1 OS=Aedes aegypti GN=ACT-1 PE=2 SV=2 7 386 6.0E-118
sp|P10990|ACT1_STRFN Actin-15A OS=Strongylocentrotus franciscanus PE=3 SV=1 7 386 6.0E-118
sp|Q91ZK5|ACTB_SIGHI Actin, cytoplasmic 1 OS=Sigmodon hispidus GN=ACTB PE=2 SV=1 7 386 7.0E-118
sp|P18600|ACT1_ARTSX Actin, clone 205 OS=Artemia sp. PE=2 SV=1 7 386 7.0E-118
sp|P53501|ACT3_DROME Actin-57B OS=Drosophila melanogaster GN=Act57B PE=1 SV=1 7 386 8.0E-118
sp|Q964E1|ACTC_BIOOB Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 SV=1 7 386 8.0E-118
sp|P0DM42|ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans GN=act-3 PE=1 SV=1 7 386 8.0E-118
sp|P0DM41|ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans GN=act-1 PE=1 SV=1 7 386 8.0E-118
sp|P68143|ACTB_OREMO Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1 7 386 8.0E-118
sp|P68142|ACTB1_TAKRU Actin, cytoplasmic 1 OS=Takifugu rubripes GN=actba PE=2 SV=1 7 386 8.0E-118
sp|P10981|ACT5_DROME Actin-87E OS=Drosophila melanogaster GN=Act87E PE=1 SV=1 7 386 9.0E-118
sp|P53464|ACTM_HELTB Actin, cytoskeletal OS=Heliocidaris tuberculata PE=3 SV=1 7 386 9.0E-118
sp|P63256|ACTG_ANSAN Actin, cytoplasmic 2 OS=Anser anser anser GN=ACTG1 PE=2 SV=1 7 386 1.0E-117
sp|Q964D9|ACTC_PLATR Actin, cytoplasmic OS=Planorbella trivolvis PE=3 SV=1 7 386 1.0E-117
sp|P53498|ACT_CHLRE Actin OS=Chlamydomonas reinhardtii PE=2 SV=1 2 386 1.0E-117
sp|P53506|ACT8_XENLA Actin, cytoplasmic type 8 OS=Xenopus laevis PE=3 SV=1 7 386 1.0E-117
sp|Q964E3|ACTC_BIOAL Actin, cytoplasmic OS=Biomphalaria alexandrina PE=3 SV=1 7 386 1.0E-117
sp|P79818|ACTB_ORYLA Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE=2 SV=2 7 386 2.0E-117
sp|P53463|ACTM_HELER Actin, cytoskeletal OS=Heliocidaris erythrogramma PE=3 SV=1 7 386 2.0E-117
sp|Q964E0|ACTC_BIOTE Actin, cytoplasmic OS=Biomphalaria tenagophila PE=3 SV=1 7 386 2.0E-117
sp|Q8X119|ACT_EXODE Actin OS=Exophiala dermatitidis PE=3 SV=1 7 386 2.0E-117
sp|Q964E2|ACTC_BIOPF Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1 7 386 2.0E-117
sp|P68555|ACT_TAESO Actin OS=Taenia solium GN=ACT1 PE=3 SV=1 7 386 2.0E-117
sp|P68556|ACT1_DIPDE Actin-1/4 OS=Diphyllobothrium dendriticum GN=ACT1 PE=2 SV=1 7 386 2.0E-117
sp|P46258|ACT3_PEA Actin-3 OS=Pisum sativum PE=2 SV=1 6 386 2.0E-117
sp|P53486|ACTB3_TAKRU Actin, cytoplasmic 3 OS=Takifugu rubripes GN=actbc PE=2 SV=1 7 386 2.0E-117
sp|Q26065|ACT_PLAMG Actin, adductor muscle OS=Placopecten magellanicus PE=2 SV=1 7 386 2.0E-117
sp|P53471|ACT2_SCHMA Actin-2 OS=Schistosoma mansoni PE=2 SV=1 7 386 2.0E-117
sp|P83968|ACT6_DROSI Actin, indirect flight muscle OS=Drosophila simulans GN=Act88F PE=3 SV=1 7 386 3.0E-117
sp|P83967|ACT6_DROME Actin, indirect flight muscle OS=Drosophila melanogaster GN=Act88F PE=1 SV=1 7 386 3.0E-117
sp|P83969|ACT1_BACDO Actin, indirect flight muscle OS=Bactrocera dorsalis PE=3 SV=1 7 386 3.0E-117
sp|P04829|ACT3_BOMMO Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3 7 386 3.0E-117
sp|P02576|ACTA_PHYPO Actin, plasmodial isoform OS=Physarum polycephalum GN=ARDA PE=1 SV=2 7 386 3.0E-117
sp|O65314|ACT_SCHDU Actin OS=Scherffelia dubia PE=2 SV=1 2 386 3.0E-117
sp|Q553U6|ACT22_DICDI Putative actin-22 OS=Dictyostelium discoideum GN=act22 PE=3 SV=1 7 386 3.0E-117
sp|Q00215|ACTC_STYPL Actin, cytoplasmic OS=Styela plicata PE=3 SV=1 7 386 4.0E-117
sp|P92179|ACTC_BIOGL Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 SV=2 7 386 4.0E-117
sp|P12716|ACTC_PISOC Actin, cytoplasmic OS=Pisaster ochraceus PE=3 SV=1 7 386 4.0E-117
sp|Q25010|ACT3A_HELAM Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=actA3a PE=2 SV=1 7 386 4.0E-117
sp|P53457|ACT3_DIPDE Actin-3 OS=Diphyllobothrium dendriticum GN=ACT3 PE=2 SV=1 7 386 4.0E-117
sp|P10989|ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act1 PE=1 SV=1 7 384 4.0E-117
sp|P53496|ACT11_ARATH Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=1 6 386 4.0E-117
sp|P84185|ACT5C_ANOGA Actin-5C OS=Anopheles gambiae GN=Act5C PE=2 SV=1 7 386 4.0E-117
sp|P84183|ACT4_BOMMO Actin, cytoplasmic A4 OS=Bombyx mori GN=A4 PE=2 SV=1 7 386 4.0E-117
sp|P84184|ACT3B_HELAM Actin-A3b, cytoplasmic OS=Helicoverpa armigera GN=actA3b PE=2 SV=1 7 386 4.0E-117
sp|P10987|ACT1_DROME Actin-5C OS=Drosophila melanogaster GN=Act5C PE=1 SV=4 7 386 4.0E-117
sp|Q9Y707|ACT2_SUIBO Actin-2 OS=Suillus bovinus GN=ACT2 PE=2 SV=1 7 386 4.0E-117
sp|P53460|ACT1_HALRO Actin, muscle 1A OS=Halocynthia roretzi GN=MA1A PE=3 SV=1 7 386 4.0E-117
sp|P49871|ACT_MANSE Actin, muscle OS=Manduca sexta PE=2 SV=1 7 386 5.0E-117
sp|P53456|ACT2_DIPDE Actin-2 OS=Diphyllobothrium dendriticum GN=ACT2 PE=2 SV=1 7 386 5.0E-117
sp|P02572|ACT2_DROME Actin-42A OS=Drosophila melanogaster GN=Act42A PE=1 SV=3 7 386 5.0E-117
sp|P41339|ACTA_LIMPO Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1 7 386 5.0E-117
sp|P17304|ACTM_APLCA Actin, muscle OS=Aplysia californica PE=2 SV=1 7 386 5.0E-117
sp|P78711|ACT_NEUCR Actin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=act PE=3 SV=2 7 386 5.0E-117
sp|Q6TCF2|ACT_GAEGA Actin OS=Gaeumannomyces graminis var. avenae GN=ACT PE=2 SV=1 7 386 5.0E-117
sp|Q9UVW9|ACTG_ACRCH Actin, gamma OS=Acremonium chrysogenum GN=ACT PE=3 SV=1 7 386 5.0E-117
sp|P41340|ACT3_LIMPO Actin-3 OS=Limulus polyphemus PE=1 SV=1 7 386 5.0E-117
sp|P20904|ACT_VOLCA Actin OS=Volvox carteri PE=3 SV=1 2 386 6.0E-117
sp|O16808|ACT_MAYDE Actin OS=Mayetiola destructor PE=2 SV=1 7 386 7.0E-117
sp|Q93131|ACTC_BRAFL Actin, cytoplasmic OS=Branchiostoma floridae PE=2 SV=1 7 386 7.0E-117
sp|P10995|ACT2_XENLA Actin, alpha skeletal muscle 2 OS=Xenopus laevis GN=act2 PE=2 SV=1 7 386 7.0E-117
sp|P20399|ACT2_XENTR Actin, alpha cardiac muscle 2 OS=Xenopus tropicalis PE=2 SV=1 7 386 7.0E-117
sp|P53494|ACT4_ARATH Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1 6 386 7.0E-117
sp|P20359|ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acnA PE=3 SV=2 7 386 8.0E-117
sp|Q93129|ACTC_BRABE Actin, cytoplasmic OS=Branchiostoma belcheri PE=2 SV=1 7 386 8.0E-117
sp|P53689|ACT_PHARH Actin OS=Phaffia rhodozyma PE=3 SV=1 7 386 8.0E-117
sp|O17320|ACT_CRAGI Actin OS=Crassostrea gigas PE=2 SV=1 7 386 9.0E-117
sp|P07836|ACT1_BOMMO Actin, muscle-type A1 OS=Bombyx mori PE=3 SV=1 7 386 9.0E-117
sp|Q54GX7|ACT10_DICDI Actin-10 OS=Dictyostelium discoideum GN=act10 PE=1 SV=1 7 386 1.0E-116
sp|P04751|ACTC_XENLA Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN=actc1 PE=2 SV=1 7 386 1.0E-116
sp|P02582|ACT1_MAIZE Actin-1 OS=Zea mays GN=ACT1 PE=3 SV=1 6 385 1.0E-116
sp|P07830|ACT1_DICDI Major actin OS=Dictyostelium discoideum GN=act1 PE=1 SV=2 7 386 1.0E-116
sp|Q25472|ACT2_MOLOC Actin, muscle-type OS=Molgula oculata PE=3 SV=1 7 386 1.0E-116
sp|P53455|ACT_AJECG Actin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_08711 PE=2 SV=2 7 386 1.0E-116
sp|P53479|ACTS_CYPCA Actin, alpha skeletal muscle OS=Cyprinus carpio GN=acta1 PE=2 SV=1 7 386 1.0E-116
sp|P53497|ACT12_ARATH Actin-12 OS=Arabidopsis thaliana GN=ACT12 PE=1 SV=1 6 386 1.0E-116
sp|P91754|ACT_LUMRU Actin (Fragment) OS=Lumbricus rubellus PE=2 SV=1 7 386 1.0E-116
sp|P49055|ACTS_CARAU Actin, alpha skeletal muscle OS=Carassius auratus GN=acta1 PE=2 SV=1 7 386 1.0E-116
sp|P41341|ACTY_LIMPO Actin-11 OS=Limulus polyphemus PE=2 SV=1 7 386 1.0E-116
sp|P68136|ACTS_RAT Actin, alpha skeletal muscle OS=Rattus norvegicus GN=Acta1 PE=1 SV=1 7 386 1.0E-116
sp|P68135|ACTS_RABIT Actin, alpha skeletal muscle OS=Oryctolagus cuniculus GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|Q5R9Q5|ACTS_PONAB Actin, alpha skeletal muscle OS=Pongo abelii GN=ACTA1 PE=2 SV=1 7 386 1.0E-116
sp|P68137|ACTS_PIG Actin, alpha skeletal muscle OS=Sus scrofa GN=ACTA1 PE=3 SV=1 7 386 1.0E-116
sp|P68134|ACTS_MOUSE Actin, alpha skeletal muscle OS=Mus musculus GN=Acta1 PE=1 SV=1 7 386 1.0E-116
sp|P68133|ACTS_HUMAN Actin, alpha skeletal muscle OS=Homo sapiens GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|P68139|ACTS_CHICK Actin, alpha skeletal muscle OS=Gallus gallus GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|P68138|ACTS_BOVIN Actin, alpha skeletal muscle OS=Bos taurus GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|O15998|ACTM_CIOSA Actin, muscle OS=Ciona savignyi PE=2 SV=1 7 386 1.0E-116
sp|P43239|ACT1_PNECA Actin-1 OS=Pneumocystis carinii PE=2 SV=1 7 384 1.0E-116
sp|O13419|ACT_BOTFU Actin OS=Botryotinia fuckeliana GN=actA PE=3 SV=1 7 386 2.0E-116
sp|Q9Y702|ACT1_SCHCO Actin-1 OS=Schizophyllum commune GN=ACT1 PE=2 SV=1 7 386 2.0E-116
sp|P30164|ACT1_PEA Actin-1 OS=Pisum sativum PE=2 SV=1 6 386 2.0E-116
sp|P92182|ACT1_LUMTE Actin-1 OS=Lumbricus terrestris GN=ACT1 PE=2 SV=1 7 386 2.0E-116
sp|Q9URS0|ACTG_PENCH Actin, gamma OS=Penicillium chrysogenum GN=ACT PE=3 SV=1 7 386 2.0E-116
sp|P53474|ACTE_STRPU Actin, cytoskeletal 3A OS=Strongylocentrotus purpuratus GN=CYIIIA PE=3 SV=1 7 386 2.0E-116
sp|P27130|ACT2_HALRO Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2 PE=2 SV=1 7 386 2.0E-116
sp|P27131|ACT1_NAEFO Actin-1 OS=Naegleria fowleri PE=2 SV=2 7 386 2.0E-116
sp|P18601|ACT2_ARTSX Actin, clone 211 OS=Artemia sp. PE=2 SV=1 7 386 2.0E-116
sp|Q6P640|ACTC_XENTR Actin, alpha cardiac muscle 1 OS=Xenopus tropicalis GN=actc1 PE=2 SV=1 7 386 2.0E-116
sp|P68035|ACTC_RAT Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=2 SV=1 7 386 2.0E-116
sp|P68033|ACTC_MOUSE Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1 7 386 2.0E-116
sp|P68032|ACTC_HUMAN Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1 7 386 2.0E-116
sp|P68034|ACTC_CHICK Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=ACTC1 PE=3 SV=1 7 386 2.0E-116
sp|Q3ZC07|ACTC_BOVIN Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACTC1 PE=2 SV=1 7 386 2.0E-116
sp|P53480|ACTC_TAKRU Actin, alpha cardiac OS=Takifugu rubripes PE=2 SV=1 7 386 2.0E-116
sp|Q10DV7|ACT1_ORYSJ Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE=2 SV=1 6 386 2.0E-116
sp|A2XLF2|ACT1_ORYSI Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2 SV=1 6 386 2.0E-116
sp|P26197|ACT2_ABSGL Actin-2 OS=Absidia glauca GN=ACT2 PE=3 SV=1 7 386 2.0E-116
sp|Q07903|ACTC_STRPU Actin, cytoskeletal 2A OS=Strongylocentrotus purpuratus GN=CYIIA PE=2 SV=1 7 386 2.0E-116
sp|P02574|ACT4_DROME Actin, larval muscle OS=Drosophila melanogaster GN=Act79B PE=1 SV=2 7 386 2.0E-116
sp|P12717|ACTM_PISOC Actin, muscle OS=Pisaster ochraceus PE=3 SV=1 7 386 3.0E-116
sp|P30165|ACT2_PEA Actin-2 OS=Pisum sativum PE=2 SV=1 6 386 3.0E-116
sp|Q96292|ACT2_ARATH Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1 6 386 3.0E-116
sp|P26183|ACT_CRYPV Actin OS=Cryptosporidium parvum PE=3 SV=1 7 386 4.0E-116
sp|P68264|ACTS_OREMO Actin, alpha skeletal muscle OS=Oreochromis mossambicus GN=acta1 PE=2 SV=1 7 386 4.0E-116
sp|P68140|ACTSA_TAKRU Actin, alpha skeletal muscle A OS=Takifugu rubripes GN=acta1a PE=2 SV=1 7 386 4.0E-116
sp|Q98972|ACTS_ORYLA Actin, alpha skeletal muscle OS=Oryzias latipes GN=acta1 PE=2 SV=1 7 386 4.0E-116
sp|Q96293|ACT8_ARATH Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2 6 386 4.0E-116
sp|P17126|ACT_HYDVU Actin, non-muscle 6.2 OS=Hydra vulgaris PE=3 SV=1 7 386 4.0E-116
sp|Q90X97|ACTS_ATRMM Actin, alpha skeletal muscle OS=Atractaspis microlepidota microlepidota GN=ACTA1 PE=2 SV=1 7 386 5.0E-116
sp|P48465|ACT_CRYNH Actin OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_00483 PE=3 SV=2 7 386 5.0E-116
sp|P90689|ACT_BRUMA Actin OS=Brugia malayi PE=1 SV=1 7 386 5.0E-116
sp|P45887|ACT5_BACDO Actin-5, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 7 386 6.0E-116
sp|Q9BYX7|ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens GN=POTEKP PE=5 SV=1 7 386 6.0E-116
sp|Q2U7A3|ACT_ASPOR Actin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=act1 PE=3 SV=1 7 386 8.0E-116
sp|P04752|ACT3_XENLA Actin, alpha skeletal muscle 3 OS=Xenopus laevis GN=act3 PE=2 SV=2 7 386 8.0E-116
sp|Q8RYC2|ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana GN=ACT5 PE=5 SV=1 7 386 9.0E-116
sp|P62738|ACTA_RAT Actin, aortic smooth muscle OS=Rattus norvegicus GN=Acta2 PE=2 SV=1 7 386 1.0E-115
sp|P62740|ACTA_RABIT Actin, aortic smooth muscle OS=Oryctolagus cuniculus GN=ACTA2 PE=2 SV=1 7 386 1.0E-115
sp|P62737|ACTA_MOUSE Actin, aortic smooth muscle OS=Mus musculus GN=Acta2 PE=1 SV=1 7 386 1.0E-115
sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1 7 386 1.0E-115
sp|P62739|ACTA_BOVIN Actin, aortic smooth muscle OS=Bos taurus GN=ACTA2 PE=1 SV=1 7 386 1.0E-115
sp|O17503|ACTC_BRALA Actin, cytoplasmic OS=Branchiostoma lanceolatum PE=2 SV=1 7 386 1.0E-115
sp|Q03341|ACT2_ECHGR Actin-2 OS=Echinococcus granulosus GN=ACTII PE=3 SV=1 7 386 1.0E-115
sp|P30168|ACT6_SOLTU Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2 6 386 1.0E-115
sp|P63269|ACTH_RAT Actin, gamma-enteric smooth muscle OS=Rattus norvegicus GN=Actg2 PE=2 SV=1 7 386 1.0E-115
sp|P63268|ACTH_MOUSE Actin, gamma-enteric smooth muscle OS=Mus musculus GN=Actg2 PE=1 SV=1 7 386 1.0E-115
sp|P63267|ACTH_HUMAN Actin, gamma-enteric smooth muscle OS=Homo sapiens GN=ACTG2 PE=1 SV=1 7 386 1.0E-115
sp|P63270|ACTH_CHICK Actin, gamma-enteric smooth muscle OS=Gallus gallus GN=ACTG2 PE=1 SV=1 7 386 1.0E-115
sp|Q5E9B5|ACTH_BOVIN Actin, gamma-enteric smooth muscle OS=Bos taurus GN=ACTG2 PE=2 SV=1 7 386 1.0E-115
sp|P53482|ACTSB_TAKRU Actin, alpha skeletal muscle B OS=Takifugu rubripes GN=acta1b PE=2 SV=1 7 386 1.0E-115
sp|P07829|ACT3_DICDI Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 SV=3 7 386 1.0E-115
sp|P08023|ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus GN=ACTA2 PE=1 SV=2 7 386 2.0E-115
sp|P53475|ACTN_STYCL Actin, muscle OS=Styela clava GN=TB12 PE=2 SV=1 7 386 2.0E-115
sp|P53461|ACTC_HALRO Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=3 SV=1 7 386 2.0E-115
sp|Q75D00|ACT_ASHGO Actin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACT1 PE=2 SV=1 2 385 2.0E-115
sp|P60010|ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1 7 385 2.0E-115
sp|P60011|ACT_SACBA Actin OS=Saccharomyces bayanus GN=ACT1 PE=3 SV=1 7 385 2.0E-115
sp|P60009|ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACT1 PE=3 SV=1 7 385 2.0E-115
sp|Q9NJV4|ACT1_NAEGR Actin-1 OS=Naegleria gruberi GN=ACT1 PE=3 SV=1 7 386 2.0E-115
sp|P17128|ACT_KLULA Actin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACT PE=3 SV=2 7 385 2.0E-115
sp|P41112|ACT1_PODCA Actin-1/2 OS=Podocoryna carnea GN=ACTIA PE=2 SV=1 7 386 3.0E-115
sp|P41113|ACT3_PODCA Actin-3 OS=Podocoryna carnea GN=ACT3 PE=3 SV=1 7 386 3.0E-115
sp|Q9UVF3|ACT_YARLI Actin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ACT1 PE=3 SV=2 7 386 3.0E-115
sp|P50138|ACT_PUCGR Actin OS=Puccinia graminis PE=3 SV=1 7 386 3.0E-115
sp|P53465|ACT1_LYTPI Actin, cytoskeletal 1 OS=Lytechinus pictus PE=2 SV=1 7 386 3.0E-115
sp|Q6P8G3|ACT3_XENTR Actin, alpha sarcomeric/skeletal OS=Xenopus tropicalis GN=act3 PE=2 SV=1 7 386 3.0E-115
sp|Q39758|ACT_FUCVE Actin OS=Fucus vesiculosus PE=2 SV=1 7 386 5.0E-115
sp|P92176|ACT2_LUMTE Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1 7 386 5.0E-115
sp|P26198|ACTM_STYCL Actin, muscle OS=Styela clava PE=2 SV=1 7 386 5.0E-115
sp|Q8BFZ3|ACTBL_MOUSE Beta-actin-like protein 2 OS=Mus musculus GN=Actbl2 PE=1 SV=1 7 386 5.0E-115
sp|O65316|ACT_MESVI Actin OS=Mesostigma viride PE=3 SV=1 2 386 7.0E-115
sp|Q9Y701|ACT1_SUIBO Actin-1 OS=Suillus bovinus GN=ACT1 PE=2 SV=1 7 386 2.0E-114
sp|P18499|ACTF_STRPU Actin, cytoskeletal 3B OS=Strongylocentrotus purpuratus GN=CYIIIB PE=2 SV=1 7 386 2.0E-114
sp|Q9P4D1|ACT_PICPG Actin OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ACT1 PE=1 SV=1 7 385 4.0E-114
sp|P53466|ACT2_LYTPI Actin, cytoskeletal 2 OS=Lytechinus pictus PE=2 SV=1 7 386 4.0E-114
sp|Q562R1|ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 7 386 7.0E-114
sp|P26182|ACT_ACHBI Actin OS=Achlya bisexualis PE=3 SV=1 7 386 1.0E-113
sp|Q9UVZ8|ACT_CANDC Actin OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ACT1 PE=3 SV=1 7 385 1.0E-113
sp|P22131|ACT1_PHYIN Actin-1 OS=Phytophthora infestans GN=ACTA PE=2 SV=1 7 386 1.0E-113
sp|P53476|ACT_TOXGO Actin OS=Toxoplasma gondii GN=ACT1 PE=3 SV=1 7 386 1.0E-113
sp|P14235|ACT_CANAX Actin OS=Candida albicans GN=ACT1 PE=3 SV=1 7 385 2.0E-113
sp|Q9Y896|ACT2_SCHCO Actin-2 OS=Schizophyllum commune GN=ACT2 PE=3 SV=1 7 386 3.0E-113
sp|P12432|ACT1_TRYBB Actin A OS=Trypanosoma brucei brucei PE=3 SV=1 7 385 4.0E-113
sp|O74258|ACT_OGAPD Actin OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=ACT PE=3 SV=2 7 385 5.0E-113
sp|Q7RME1|ACT1_PLAYO Actin-1 OS=Plasmodium yoelii yoelii GN=PY02240 PE=3 SV=1 7 386 6.0E-113
sp|P86287|ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) PE=1 SV=1 7 386 9.0E-113
sp|Q8I4X0|ACT1_PLAF7 Actin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PFL2215w PE=3 SV=1 7 386 9.0E-113
sp|P53504|ACT1_SORBI Actin-1 OS=Sorghum bicolor GN=AC1 PE=2 SV=1 6 386 1.0E-112
sp|Q9UVX4|ACT_COPC7 Actin OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACT1 PE=3 SV=1 7 386 1.0E-112
sp|P10988|ACT1_PLAFO Actin-1 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 7 386 2.0E-112
sp|P22132|ACT2_PHYIN Actin-2 OS=Phytophthora infestans GN=ACTB PE=2 SV=1 7 386 2.0E-112
sp|P53500|ACT_CYAME Actin OS=Cyanidioschyzon merolae PE=3 SV=1 7 386 3.0E-112
sp|P30172|ACT12_SOLTU Actin-100 (Fragment) OS=Solanum tuberosum GN=AC100 PE=3 SV=1 19 386 3.0E-112
sp|P13363|ACT_PHYME Actin OS=Phytophthora megasperma PE=3 SV=1 7 386 1.0E-111
sp|P84856|ACTB_CHLPG Actin, cytoplasmic 1 OS=Chlorocebus pygerythrus GN=ACTB PE=1 SV=1 17 386 1.0E-111
sp|Q00214|ACTM_STYPL Actin, muscle OS=Styela plicata PE=3 SV=1 7 386 2.0E-111
sp|P07828|ACT18_DICDI Actin-18 OS=Dictyostelium discoideum GN=act18 PE=3 SV=3 7 386 4.0E-111
sp|P12433|ACT2_TRYBB Actin B OS=Trypanosoma brucei brucei PE=3 SV=1 7 385 5.0E-111
sp|P53502|ACT_FUCDI Actin OS=Fucus distichus PE=2 SV=1 7 386 7.0E-111
sp|P53499|ACT_CHOCR Actin OS=Chondrus crispus GN=AC PE=2 SV=1 5 386 2.0E-110
sp|Q93132|ACTM_BRAFL Actin, muscle OS=Branchiostoma floridae PE=2 SV=1 6 386 2.0E-110
sp|P86288|ACT2_PLAFX Actin-2 OS=Plasmodium falciparum (isolate HB3) PE=3 SV=1 7 386 2.0E-110
sp|Q8ILW9|ACT2_PLAF7 Actin-2 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0124 PE=3 SV=1 7 386 2.0E-110
sp|O17502|ACTM_BRALA Actin, muscle OS=Branchiostoma lanceolatum PE=2 SV=1 6 386 3.0E-110
sp|Q93130|ACTM_BRABE Actin, muscle OS=Branchiostoma belcheri PE=2 SV=1 6 386 5.0E-110
sp|Q4Z1L3|ACT1_PLABA Actin-1 OS=Plasmodium berghei (strain Anka) GN=PB000323.01.0 PE=1 SV=1 7 386 7.0E-110
sp|P02581|ACT1_SOYBN Actin-1 OS=Glycine max GN=SAC1 PE=3 SV=2 6 386 7.0E-110
sp|P53477|ACT_TRYCR Actin OS=Trypanosoma cruzi PE=3 SV=1 7 386 8.0E-110
sp|Q7RPB4|ACT2_PLAYO Actin-2 OS=Plasmodium yoelii yoelii GN=PY01545 PE=3 SV=1 7 386 2.0E-109
sp|P14883|ACT2_PLAFO Actin-2 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 7 386 2.0E-109
sp|P10993|ACT2_TETPY Actin, cytoplasmic OS=Tetrahymena pyriformis PE=3 SV=2 3 386 4.0E-109
sp|P23343|ACT1_DAUCA Actin-1 OS=Daucus carota PE=2 SV=1 6 386 1.0E-108
sp|P12431|ACTM_STRPU Actin, muscle OS=Strongylocentrotus purpuratus PE=3 SV=1 7 376 2.0E-108
sp|P10992|ACT1_TETTH Actin, macronuclear OS=Tetrahymena thermophila PE=1 SV=3 5 386 2.0E-108
sp|P18602|ACT3_ARTSX Actin, clone 302 (Fragment) OS=Artemia sp. PE=2 SV=1 52 386 2.0E-108
sp|A5DQP9|ACT_PICGU Actin OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ACT1 PE=3 SV=1 17 385 4.0E-108
sp|Q8SWN8|ACT_ENCCU Actin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0460 PE=1 SV=2 7 386 6.0E-108
sp|P02580|ACT3_SOYBN Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2 6 386 7.0E-108
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 7 386 1.0E-107
sp|Q55EU6|ACT23_DICDI Putative actin-23 OS=Dictyostelium discoideum GN=act23 PE=1 SV=1 17 386 2.0E-107
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 7 386 3.0E-107
sp|Q99023|ACT_HYPJE Actin OS=Hypocrea jecorina GN=act PE=3 SV=1 7 385 1.0E-106
sp|Q4YU79|ACT2_PLABA Actin-2 OS=Plasmodium berghei (strain Anka) GN=PB001050.02.0 PE=1 SV=1 7 386 1.0E-106
sp|P24263|ACTD_PHYPO Actin, spherule isoform OS=Physarum polycephalum GN=ARDD PE=2 SV=2 7 386 2.0E-106
sp|P30161|ACT_COSCS Actin (Fragment) OS=Costaria costata PE=3 SV=2 52 386 3.0E-106
sp|P45520|ACT_LEIMA Actin OS=Leishmania major PE=3 SV=1 7 386 3.0E-106
sp|P53468|ACT1_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 1 386 3.0E-106
sp|P45521|ACT_PROCL Actin (Fragment) OS=Procambarus clarkii PE=1 SV=1 57 386 5.0E-106
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 7 386 1.0E-105
sp|Q96483|ACT2_SOLLC Actin-51 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 18 362 2.0E-105
sp|P53491|ACT_ACEPE Actin (Fragment) OS=Acetabularia peniculus PE=3 SV=1 19 386 3.0E-105
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 7 386 3.0E-105
sp|Q96484|ACT3_SOLLC Actin-52 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 18 362 4.0E-105
sp|O00937|ACT_STECV Actin OS=Sterkiella cavicola PE=3 SV=2 1 386 2.0E-104
sp|P81228|ACT5_SOLTU Actin-66 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 2.0E-104
sp|P55805|ACT2_STENO Actin, cytoplasmic OS=Sterkiella nova GN=MIC-ACT-1 PE=3 SV=1 1 386 2.0E-104
sp|Q96482|ACT1_SOLLC Actin-41 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 18 362 2.0E-104
sp|P12715|ACT1_STENO Actin, cytoplasmic OS=Sterkiella nova PE=3 SV=1 1 386 4.0E-104
sp|P81229|ACT8_SOLTU Actin-79 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 5.0E-104
sp|P93372|ACT4_TOBAC Actin-66 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 6.0E-104
sp|P93371|ACT5_TOBAC Actin-93 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 18 362 8.0E-104
sp|P51775|ACT_GIAIN Actin OS=Giardia intestinalis PE=3 SV=1 5 386 1.0E-103
sp|P93586|ACT2_SOLTU Actin-46 (Fragment) OS=Solanum tuberosum PE=3 SV=1 18 362 1.0E-103
sp|P93584|ACT9_SOLTU Actin-82 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 2.0E-103
sp|Q54HF0|ACT25_DICDI Putative actin-25 OS=Dictyostelium discoideum GN=act25 PE=3 SV=1 7 386 3.0E-103
sp|P93376|ACT6_TOBAC Actin-103 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 3.0E-103
sp|P53483|ACTX_TAKRU Actin, alpha anomalous OS=Takifugu rubripes PE=2 SV=1 7 385 3.0E-103
sp|P20360|ACT_EUPCR Actin, cytoplasmic OS=Euplotes crassus PE=3 SV=1 7 386 4.0E-103
sp|P93375|ACT7_TOBAC Actin-104 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 4.0E-103
sp|Q03342|ACT3_ECHGR Actin-3 (Fragment) OS=Echinococcus granulosus GN=ACTIII PE=2 SV=1 69 386 7.0E-103
sp|P30169|ACT7_SOLTU Actin-75 OS=Solanum tuberosum GN=AC75 PE=3 SV=1 6 386 1.0E-102
sp|P93373|ACT3_TOBAC Actin-54 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 18 362 2.0E-102
sp|P93374|ACT2_TOBAC Actin-53 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 4.0E-102
sp|Q554S6|ACT17_DICDI Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1 2 386 5.0E-102
sp|P27132|ACT2_NAEFO Actin-2 (Fragment) OS=Naegleria fowleri PE=2 SV=1 9 386 6.0E-102
sp|P93587|ACT1_SOLTU Actin-42 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 1.0E-101
sp|P93585|ACT4_SOLTU Actin-65 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 4.0E-101
sp|Q55CU2|ACT26_DICDI Putative actin-26 OS=Dictyostelium discoideum GN=act26 PE=3 SV=1 3 386 8.0E-101
sp|P53469|ACT2_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 1 386 2.0E-99
sp|Q54HF1|ACT24_DICDI Putative actin-24 OS=Dictyostelium discoideum GN=act24 PE=3 SV=1 7 386 4.0E-99
sp|Q96481|ACT4_SOLLC Actin-105 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 19 362 2.0E-98
sp|Q8R5C5|ACTY_MOUSE Beta-centractin OS=Mus musculus GN=Actr1b PE=1 SV=1 6 386 4.0E-98
sp|P85515|ACTZ_RAT Alpha-centractin OS=Rattus norvegicus GN=Actr1a PE=1 SV=1 6 386 4.0E-98
sp|P61164|ACTZ_MOUSE Alpha-centractin OS=Mus musculus GN=Actr1a PE=1 SV=1 6 386 4.0E-98
sp|Q4R6J9|ACTZ_MACFA Alpha-centractin OS=Macaca fascicularis GN=ACTR1A PE=2 SV=1 6 386 4.0E-98
sp|P61163|ACTZ_HUMAN Alpha-centractin OS=Homo sapiens GN=ACTR1A PE=1 SV=1 6 386 4.0E-98
sp|P61162|ACTZ_CANLF Alpha-centractin OS=Canis lupus familiaris GN=ACTR1A PE=2 SV=1 6 386 4.0E-98
sp|A4IFE3|ACTY_BOVIN Beta-centractin OS=Bos taurus GN=ACTR1B PE=2 SV=1 6 386 5.0E-98
sp|P45891|ACTY_DROME Actin-like protein 53D OS=Drosophila melanogaster GN=Arp53D PE=2 SV=2 7 386 6.0E-98
sp|P42025|ACTY_HUMAN Beta-centractin OS=Homo sapiens GN=ACTR1B PE=1 SV=1 6 386 1.0E-97
sp|P23344|ACT2_DAUCA Actin-2 OS=Daucus carota PE=2 SV=1 6 386 3.0E-96
sp|Q54I79|ACTY_DICDI Centractin OS=Dictyostelium discoideum GN=arpA PE=1 SV=1 6 386 1.0E-94
sp|P45889|ACTZ_DROME Actin-related protein 1 OS=Drosophila melanogaster GN=Arp1 PE=2 SV=2 6 386 2.0E-94
sp|P93738|ACT9_ARATH Putative actin-9 OS=Arabidopsis thaliana GN=ACT9 PE=5 SV=1 6 386 2.0E-93
sp|Q8BXF8|ACTT3_MOUSE Actin-related protein T3 OS=Mus musculus GN=Actrt3 PE=1 SV=1 2 386 4.0E-92
sp|P38673|ACTZ_NEUCR Actin-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-4 PE=3 SV=1 6 387 5.0E-92
sp|P42023|ACTZ_PNECA Actin-2 OS=Pneumocystis carinii PE=2 SV=1 6 378 6.0E-92
sp|P02583|ACT2_OXYFA Actin, cytoplasmic OS=Oxytricha fallax PE=3 SV=1 1 386 1.0E-90
sp|Q92192|ACT_CALFI Actin (Fragment) OS=Calanus finmarchicus PE=2 SV=1 81 370 3.0E-90
sp|Q9BYD9|ACTT3_HUMAN Actin-related protein T3 OS=Homo sapiens GN=ACTRT3 PE=2 SV=1 6 386 4.0E-87
sp|P53503|ACT1_OXYFA Actin, macronuclear OS=Oxytricha fallax PE=3 SV=1 1 386 7.0E-87
sp|Q2TA43|ACTT2_BOVIN Actin-related protein T2 OS=Bos taurus GN=ACTRT2 PE=2 SV=1 3 386 1.0E-86
sp|Q8TDY3|ACTT2_HUMAN Actin-related protein T2 OS=Homo sapiens GN=ACTRT2 PE=2 SV=2 3 386 2.0E-86
sp|Q92193|ACT_CRAVI Actin (Fragment) OS=Crassostrea virginica PE=2 SV=1 87 362 3.0E-86
sp|Q4R317|ACTT2_MACFA Actin-related protein T2 OS=Macaca fascicularis GN=ACTRT2 PE=2 SV=1 3 386 6.0E-86
sp|Q9D9L5|ACTT2_MOUSE Actin-related protein T2 OS=Mus musculus GN=Actrt2 PE=2 SV=1 3 386 6.0E-84
sp|Q8TDG2|ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens GN=ACTRT1 PE=2 SV=2 1 386 2.0E-82
sp|Q4R821|ACTT1_MACFA Actin-related protein T1 OS=Macaca fascicularis GN=ACTRT1 PE=2 SV=1 5 386 2.0E-80
sp|Q9D9J3|ACTT1_MOUSE Actin-related protein T1 OS=Mus musculus GN=Actrt1 PE=2 SV=1 5 386 3.0E-78
sp|O94630|ARP1_SCHPO Centractin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp1 PE=3 SV=1 6 362 5.0E-78
sp|Q54HE9|ACT27_DICDI Putative actin-27 OS=Dictyostelium discoideum GN=act27 PE=3 SV=2 3 384 6.0E-78
sp|Q54HE7|ACT28_DICDI Putative actin-28 OS=Dictyostelium discoideum GN=act28 PE=3 SV=1 3 380 1.0E-76
sp|Q5XIK1|ACTT1_RAT Actin-related protein T1 OS=Rattus norvegicus GN=Actrt1 PE=2 SV=1 5 386 2.0E-76
sp|P38696|ARP1_YEAST Centractin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP1 PE=1 SV=1 6 383 2.0E-75
sp|Q641W9|ACL7A_RAT Actin-like protein 7A OS=Rattus norvegicus GN=Actl7a PE=1 SV=1 7 384 2.0E-68
sp|Q4R6Q3|ACL7A_MACFA Actin-like protein 7A OS=Macaca fascicularis GN=ACTL7A PE=2 SV=1 7 384 3.0E-68
sp|Q9QY84|ACL7A_MOUSE Actin-like protein 7A OS=Mus musculus GN=Actl7a PE=1 SV=1 7 384 6.0E-68
sp|Q95JK8|ACL7B_MACFA Actin-like protein 7B OS=Macaca fascicularis GN=ACTL7B PE=2 SV=1 7 380 7.0E-68
sp|Q54L54|ACT29_DICDI Putative actin-29 OS=Dictyostelium discoideum GN=act29 PE=3 SV=1 7 386 1.0E-67
sp|Q9Y614|ACL7B_HUMAN Actin-like protein 7B OS=Homo sapiens GN=ACTL7B PE=2 SV=1 7 380 3.0E-67
sp|Q32KZ2|ACL7A_BOVIN Actin-like protein 7A OS=Bos taurus GN=ACTL7A PE=2 SV=1 7 384 3.0E-67
sp|Q9Y615|ACL7A_HUMAN Actin-like protein 7A OS=Homo sapiens GN=ACTL7A PE=1 SV=1 7 384 3.0E-67
sp|Q4QR76|ACL7B_RAT Actin-like protein 7B OS=Rattus norvegicus GN=Actl7b PE=1 SV=1 7 380 2.0E-66
sp|Q32L91|ACL7B_BOVIN Actin-like protein 7B OS=Bos taurus GN=ACTL7B PE=2 SV=1 7 380 3.0E-66
sp|Q9QY83|ACL7B_MOUSE Actin-like protein 7B OS=Mus musculus GN=Actl7b PE=1 SV=2 7 380 5.0E-65
sp|P78712|ARP3_NEUCR Actin-related protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-3 PE=2 SV=2 5 387 7.0E-65
sp|Q9N4I0|ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans GN=arx-1 PE=3 SV=1 5 389 1.0E-64
sp|Q2T9W4|ACTL9_BOVIN Actin-like protein 9 OS=Bos taurus GN=ACTL9 PE=2 SV=1 7 384 1.0E-63
sp|Q8TC94|ACTL9_HUMAN Actin-like protein 9 OS=Homo sapiens GN=ACTL9 PE=1 SV=3 7 386 3.0E-63
sp|Q61WW9|ARP3_CAEBR Actin-related protein 3 OS=Caenorhabditis briggsae GN=arx-1 PE=3 SV=1 5 389 6.0E-63
sp|Q6AY16|ACTL9_RAT Actin-like protein 9 OS=Rattus norvegicus GN=Actl9 PE=2 SV=1 7 384 2.0E-62
sp|Q8CG27|ACTL9_MOUSE Actin-like protein 9 OS=Mus musculus GN=Actl9 PE=1 SV=1 7 384 1.0E-61
sp|P32390|ARP3_SCHPO Actin-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act2 PE=1 SV=1 6 387 2.0E-61
sp|P47117|ARP3_YEAST Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP3 PE=1 SV=1 3 387 3.0E-61
sp|P30170|ACT10_SOLTU Actin-85C (Fragment) OS=Solanum tuberosum GN=AC85C PE=3 SV=1 19 215 2.0E-60
sp|Q9SAF1|ARP3_ARATH Actin-related protein 3 OS=Arabidopsis thaliana GN=ARP3 PE=1 SV=1 5 384 2.0E-60
sp|Q6K908|ARP3_ORYSJ Actin-related protein 3 OS=Oryza sativa subsp. japonica GN=ARP3 PE=2 SV=1 5 384 2.0E-60
sp|A2X6S3|ARP3_ORYSI Actin-related protein 3 OS=Oryza sativa subsp. indica GN=ARP3 PE=3 SV=2 5 384 2.0E-60
sp|Q641P0|ARP3B_MOUSE Actin-related protein 3B OS=Mus musculus GN=Actr3b PE=1 SV=1 2 384 7.0E-59
sp|Q9P1U1|ARP3B_HUMAN Actin-related protein 3B OS=Homo sapiens GN=ACTR3B PE=2 SV=1 2 384 3.0E-58
sp|P42528|ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum GN=arpC PE=1 SV=1 5 384 4.0E-58
sp|P53490|ARP3_ACACA Actin-related protein 3 OS=Acanthamoeba castellanii GN=ARP3 PE=2 SV=1 5 384 1.0E-56
sp|Q90WD0|ARP3_CHICK Actin-related protein 3 OS=Gallus gallus GN=ACTR3 PE=2 SV=1 2 384 1.0E-56
sp|P32392|ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster GN=Arp3 PE=2 SV=3 2 384 6.0E-56
sp|D0LWX4|BARP_HALO1 Bacterial actin-related protein OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=barP PE=2 SV=1 6 384 3.0E-55
sp|Q4V7C7|ARP3_RAT Actin-related protein 3 OS=Rattus norvegicus GN=Actr3 PE=1 SV=1 2 384 9.0E-55
sp|Q99JY9|ARP3_MOUSE Actin-related protein 3 OS=Mus musculus GN=Actr3 PE=1 SV=3 2 384 9.0E-55
sp|Q5R8R1|ARP3_PONAB Actin-related protein 3 OS=Pongo abelii GN=ACTR3 PE=2 SV=3 2 384 1.0E-54
sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens GN=ACTR3 PE=1 SV=3 2 384 1.0E-54
sp|P61157|ARP3_BOVIN Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=1 SV=3 2 384 1.0E-54
sp|O73723|ARP3_TAKRU Actin-related protein 3 OS=Takifugu rubripes GN=actr3 PE=3 SV=1 2 384 6.0E-54
sp|Q84M92|ARP4_ARATH Actin-related protein 4 OS=Arabidopsis thaliana GN=ARP4 PE=1 SV=1 7 389 5.0E-49
sp|Q11212|ACT_SPOLI Actin (Fragment) OS=Spodoptera littoralis PE=2 SV=1 9 175 2.0E-48
sp|A2AKE7|ACL10_MOUSE Actin-like protein 10 OS=Mus musculus GN=Actl10 PE=3 SV=1 70 381 8.0E-47
sp|Q9H568|ACTL8_HUMAN Actin-like protein 8 OS=Homo sapiens GN=ACTL8 PE=1 SV=1 7 379 7.0E-46
sp|Q8L4Y5|ARP7_ARATH Actin-related protein 7 OS=Arabidopsis thaliana GN=ARP7 PE=1 SV=1 7 386 1.0E-44
sp|Q25381|ACTM_LYTPI Actin, muscle (Fragment) OS=Lytechinus pictus PE=3 SV=1 206 386 2.0E-44
sp|Q25379|ACT3_LYTPI Actin, cytoskeletal 3 (Fragment) OS=Lytechinus pictus PE=3 SV=1 206 386 4.0E-44
sp|A3ANB5|ARP7_ORYSJ Actin-related protein 7 OS=Oryza sativa subsp. japonica GN=ARP7 PE=2 SV=2 7 386 6.0E-43
sp|A2XMK6|ARP7_ORYSI Actin-related protein 7 OS=Oryza sativa subsp. indica GN=ARP7 PE=2 SV=2 7 386 6.0E-43
sp|Q6C061|ARP4_YARLI Actin-related protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP4 PE=3 SV=1 7 380 2.0E-42
sp|Q6ZJW9|ARP4_ORYSJ Actin-related protein 4 OS=Oryza sativa subsp. japonica GN=ARP4 PE=2 SV=1 7 389 2.0E-40
sp|A2YR10|ARP4_ORYSI Actin-related protein 4 OS=Oryza sativa subsp. indica GN=ARP4 PE=3 SV=2 7 389 2.0E-40
sp|Q25380|ACT4_LYTPI Actin, cytoskeletal 4 (Fragment) OS=Lytechinus pictus PE=3 SV=1 216 381 3.0E-39
sp|P24902|ACT_PINCO Actin (Fragment) OS=Pinus contorta PE=3 SV=1 217 386 4.0E-38
sp|Q8LGE3|ARP6_ARATH Actin-related protein 6 OS=Arabidopsis thaliana GN=ARP6 PE=1 SV=1 7 380 5.0E-38
sp|Q4R333|ACL6A_MACFA Actin-like protein 6A OS=Macaca fascicularis GN=ACTL6A PE=2 SV=1 7 389 4.0E-37
sp|Q09849|ARP42_SCHPO SWI/SNF and RSC complexes subunit arp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp42 PE=1 SV=2 5 380 6.0E-37
sp|O96019|ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens GN=ACTL6A PE=1 SV=1 7 389 8.0E-37
sp|Q9Z2N8|ACL6A_MOUSE Actin-like protein 6A OS=Mus musculus GN=Actl6a PE=1 SV=2 7 389 1.0E-36
sp|Q9GZN1|ARP6_HUMAN Actin-related protein 6 OS=Homo sapiens GN=ACTR6 PE=1 SV=1 7 386 5.0E-36
sp|Q6C982|ARP6_YARLI Actin-like protein ARP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP6 PE=3 SV=1 56 386 6.0E-36
sp|Q9D864|ARP6_MOUSE Actin-related protein 6 OS=Mus musculus GN=Actr6 PE=1 SV=2 7 386 1.0E-35
sp|O94805|ACL6B_HUMAN Actin-like protein 6B OS=Homo sapiens GN=ACTL6B PE=1 SV=1 7 389 3.0E-35
sp|Q9DEE9|ARP6_CHICK Actin-related protein 6 OS=Gallus gallus GN=ACTR6 PE=1 SV=1 7 386 3.0E-35
sp|P86173|ACL6B_RAT Actin-like protein 6B OS=Rattus norvegicus GN=Actl6b PE=1 SV=2 7 389 3.0E-35
sp|Q99MR0|ACL6B_MOUSE Actin-like protein 6B OS=Mus musculus GN=Actl6b PE=1 SV=1 7 389 3.0E-35
sp|A4FUX8|ACL6B_BOVIN Actin-like protein 6B OS=Bos taurus GN=ACTL6B PE=2 SV=1 7 389 3.0E-35
sp|Q5NBI2|ARP6_ORYSJ Actin-related protein 6 OS=Oryza sativa subsp. japonica GN=ARP6 PE=2 SV=1 7 380 9.0E-35
sp|A2WNB0|ARP6_ORYSI Actin-related protein 6 OS=Oryza sativa subsp. indica GN=ARP6 PE=3 SV=1 7 380 9.0E-35
sp|P10982|ACT1_ABSGL Actin-1 (Fragment) OS=Absidia glauca GN=ACT1 PE=3 SV=1 7 140 5.0E-32
sp|Q9P7X7|ARP4_SCHPO Actin-related protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp5 PE=3 SV=1 7 380 2.0E-31
sp|Q5JWF8|ACL10_HUMAN Actin-like protein 10 OS=Homo sapiens GN=ACTL10 PE=2 SV=1 136 384 4.0E-30
sp|P10994|ACTS_PLEWA Actin, alpha skeletal muscle (Fragment) OS=Pleurodeles waltl PE=2 SV=1 253 386 2.0E-29
sp|Q5AW89|ARP4_EMENI Actin-related protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp4 PE=3 SV=1 7 386 2.0E-29
sp|Q09443|ARP6_CAEEL Actin-like protein C08B11.6 OS=Caenorhabditis elegans GN=arp-6 PE=2 SV=3 7 380 4.0E-28
sp|P00544|FGR_FSVGR Tyrosine-protein kinase transforming protein Fgr OS=Feline sarcoma virus (strain Gardner-Rasheed) GN=V-FGR PE=3 SV=1 7 137 6.0E-28
sp|Q7S6X6|ARP6_NEUCR Actin-related protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-6 PE=3 SV=1 2 380 2.0E-27
sp|Q7XR80|ARP8_ORYSJ Actin-related protein 8 OS=Oryza sativa subsp. japonica GN=ARP8 PE=2 SV=1 91 382 2.0E-27
sp|A8WAT2|ARP8_ORYSI Actin-related protein 8 OS=Oryza sativa subsp. indica GN=ARP8 PE=3 SV=1 91 382 2.0E-27
sp|Q39596|ACT_OXYRB Actin (Fragment) OS=Oxybasis rubra PE=3 SV=1 87 169 5.0E-27
sp|P45890|ARP6_DROME Actin-related protein 6 OS=Drosophila melanogaster GN=Arp6 PE=1 SV=1 7 380 1.0E-26
sp|O94241|ARP6_SCHPO Actin-like protein arp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp6 PE=3 SV=1 1 322 1.0E-25
sp|Q5AXH1|ARP6_EMENI Actin-like protein arp6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp6 PE=3 SV=1 7 380 4.0E-25
sp|P86700|ACT_CHIOP Actin, muscle (Fragments) OS=Chionoecetes opilio PE=1 SV=1 18 334 1.0E-24
sp|Q4W9M3|ARP6_ASPFU Actin-like protein arp6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp6 PE=3 SV=1 7 380 3.0E-24
sp|Q4WHA3|ARP4_ASPFU Actin-related protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp4 PE=3 SV=1 7 386 6.0E-23
sp|Q9C0K3|ARP3C_HUMAN Actin-related protein 3C OS=Homo sapiens GN=ACTR3C PE=2 SV=1 125 297 6.0E-22
sp|P0CM04|ARP6_CRYNJ Actin-like protein ARP6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARP6 PE=3 SV=1 1 388 8.0E-22
sp|P0CM05|ARP6_CRYNB Actin-like protein ARP6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARP6 PE=3 SV=1 1 388 8.0E-22
sp|Q4P2E8|ARP4_USTMA Actin-related protein 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ARP4 PE=3 SV=1 77 385 2.0E-21
sp|Q9FKT0|ARP8_ARATH Actin-related protein 8 OS=Arabidopsis thaliana GN=ARP8 PE=2 SV=1 4 320 6.0E-20
sp|Q9QZB7|ARP10_MOUSE Actin-related protein 10 OS=Mus musculus GN=Actr10 PE=1 SV=2 2 380 7.0E-20
sp|Q9NZ32|ARP10_HUMAN Actin-related protein 10 OS=Homo sapiens GN=ACTR10 PE=1 SV=1 2 380 3.0E-19
sp|P80428|ARP4_YEAST Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 7 231 5.0E-19
sp|Q4IPI4|ARP4_GIBZE Actin-related protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ARP4 PE=3 SV=1 7 386 6.0E-19
sp|Q3ZBD2|ARP10_BOVIN Actin-related protein 10 OS=Bos taurus GN=ACTR10 PE=2 SV=1 2 380 5.0E-18
sp|Q940Z2|ARP5_ARATH Actin-related protein 5 OS=Arabidopsis thaliana GN=ARP5 PE=1 SV=2 6 243 2.0E-17
sp|Q9Y7X8|ARP5_SCHPO Actin-like protein arp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp5 PE=1 SV=1 1 195 4.0E-17
sp|Q54KZ7|ARP6_DICDI Actin-related protein 6 OS=Dictyostelium discoideum GN=arpF PE=3 SV=1 7 233 2.0E-16
sp|Q7SHR0|ARP4_NEUCR Actin-related protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-4 PE=3 SV=2 7 386 8.0E-16
sp|Q17GZ9|ARP5_AEDAE Actin-related protein 5 OS=Aedes aegypti GN=Arp5 PE=3 SV=1 4 224 1.0E-15
sp|Q6CSB9|ARP4_KLULA Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 7 198 8.0E-15
sp|Q754G5|ARP4_ASHGO Actin-related protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP4 PE=3 SV=1 7 268 8.0E-15
sp|Q6BML9|ARP6_DEBHA Actin-like protein ARP6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARP6 PE=3 SV=2 7 388 2.0E-14
sp|Q5AC48|ARP4_CANAL Actin-related protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP4 PE=3 SV=2 7 196 7.0E-14
sp|P59679|ARP8_DANRE Actin-related protein 8 OS=Danio rerio GN=actr8 PE=2 SV=1 83 294 7.0E-14
sp|Q12509|ARP6_YEAST Actin-like protein ARP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP6 PE=1 SV=1 5 321 1.0E-13
sp|Q6FJV8|ARP4_CANGA Actin-related protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP4 PE=3 SV=1 7 198 3.0E-13
sp|B5X2S3|ARP8_SALSA Actin-related protein 8 OS=Salmo salar GN=actr8 PE=2 SV=1 83 266 4.0E-13
sp|Q74ZV8|ARP6_ASHGO Actin-like protein ARP6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP6 PE=3 SV=1 65 321 4.0E-13
sp|Q54E71|ARP5_DICDI Actin-related protein 5 OS=Dictyostelium discoideum GN=arpE PE=3 SV=1 2 222 6.0E-13
sp|Q9H9F9|ARP5_HUMAN Actin-related protein 5 OS=Homo sapiens GN=ACTR5 PE=1 SV=2 226 386 6.0E-13
sp|Q5AP59|ARP6_CANAL Actin-like protein ARP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP6 PE=3 SV=1 67 388 1.0E-12
sp|Q9C9B2|ARP4A_ARATH Actin-related protein 4A OS=Arabidopsis thaliana GN=ARP4A PE=2 SV=1 7 120 2.0E-12
sp|Q6CJF4|ARP6_KLULA Actin-like protein ARP6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP6 PE=3 SV=1 5 321 2.0E-12
sp|Q6FKE7|ARP6_CANGA Actin-like protein ARP6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP6 PE=3 SV=1 72 327 1.0E-11
sp|Q9H9F9|ARP5_HUMAN Actin-related protein 5 OS=Homo sapiens GN=ACTR5 PE=1 SV=2 4 195 1.0E-09
sp|P80428|ARP4_YEAST Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 265 380 4.0E-09
sp|Q54KZ7|ARP6_DICDI Actin-related protein 6 OS=Dictyostelium discoideum GN=arpF PE=3 SV=1 248 380 4.0E-09
sp|Q6FJV8|ARP4_CANGA Actin-related protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP4 PE=3 SV=1 272 384 3.0E-08
sp|Q754G5|ARP4_ASHGO Actin-related protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP4 PE=3 SV=1 271 386 1.0E-07
sp|Q5AC48|ARP4_CANAL Actin-related protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP4 PE=3 SV=2 275 386 4.0E-07
sp|Q6CSB9|ARP4_KLULA Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 270 386 5.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6232 0.7207 0.0054 0.0724 0.1146 0.0057 0.1379 0.0085 0.1052 0.0261

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1973
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4444
Ophiocordyceps australis map64 (Brazil) OphauB2|7560
Ophiocordyceps camponoti-floridani Ophcf2|06904
Ophiocordyceps camponoti-rufipedis Ophun1|1374
Ophiocordyceps kimflemingae Ophio5|5078
Ophiocordyceps subramaniannii Hirsu2|2164 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2164
MGNPPPIVLDGGTGFLKVGYAAQNFPEHQYPSIVGRPILRSEEKTDSDVIIKDIMCGDEAAAARTMLQISYPMEN
GIVKKWDDMQYLWDYTFFEKLKVDPSGQKILLTEPPMNPLKNREQMCEVMFDRYGFGGVYVAIQAVLALYAQGLS
SGVVVDSGDGVTHIVPVYESVVLNHLTKRLDVAGRDVTRNLIKLLLRRGYALNRTADFETVRQIKEKLCYVSYDL
ELDKRLSEDTTVLVENYTLPDGRVIRVGSERFEAPECLFQPHLVDSESPGLGEFLFNTIQSADVDIRASLFKAIV
LSGGSSMYPGLPSRLEKELKQLWLTRALQGNPERLGKFKVRIEDPPRRRHMVFLGGAVLANIMADNESMWVTKAE
WDEQGPRVLEKFGPR*
Coding >Hirsu2|2164
ATGGGAAACCCACCGCCTATCGTCCTCGACGGGGGAACTGGCTTCCTCAAGGTTGGCTATGCGGCGCAAAACTTC
CCCGAGCACCAGTACCCGTCGATCGTCGGGCGGCCGATCCTGCGATCCGAGGAGAAGACGGACAGCGATGTGATA
ATCAAGGACATCATGTGCGGCGACGAGGCGGCGGCCGCCCGAACCATGCTCCAGATCAGCTATCCCATGGAGAAC
GGCATCGTGAAGAAGTGGGACGACATGCAGTACCTCTGGGACTACACCTTCTTCGAGAAGCTCAAGGTCGATCCC
AGCGGGCAGAAGATCCTGCTGACGGAGCCACCCATGAACCCTCTCAAGAATCGGGAACAGATGTGCGAGGTCATG
TTTGACCGCTATGGCTTCGGCGGCGTCTACGTCGCCATCCAGGCGGTCCTGGCCTTGTACGCGCAGGGTCTCAGC
TCGGGTGTCGTGGTCGACTCGGGCGACGGCGTCACGCATATTGTCCCCGTATACGAGTCGGTGGTGCTGAACCAC
CTAACGAAGAGGCTGGACGTTGCCGGGCGCGACGTGACGCGCAACTTGATCAAGCTTCTCCTGCGCCGCGGCTAC
GCGCTGAACCGGACGGCCGACTTCGAGACGGTGCGGCAGATCAAGGAGAAGCTGTGCTACGTGTCGTACGACCTG
GAGCTGGACAAGCGGCTGAGCGAGGACACAACGGTGCTGGTGGAGAACTACACGCTGCCCGACGGGCGGGTGATC
CGGGTGGGCAGCGAGCGGTTCGAGGCGCCCGAGTGCCTGTTCCAGCCGCATCTGGTAGACAGCGAGTCGCCGGGG
CTGGGCGAGTTCCTCTTCAACACGATCCAGTCGGCCGACGTGGACATCCGGGCGTCGCTGTTCAAGGCGATCGTG
CTGTCGGGGGGCAGCAGCATGTACCCGGGGCTGCCGTCGCGGCTGGAGAAAGAGCTGAAGCAGCTGTGGCTGACG
CGGGCGTTGCAGGGCAACCCGGAGCGGCTGGGCAAGTTCAAGGTGCGGATAGAGGATCCGCCGCGGCGGAGACAT
ATGGTCTTCCTCGGGGGCGCGGTGCTGGCCAACATCATGGCCGACAACGAGAGCATGTGGGTGACTAAGGCGGAG
TGGGACGAGCAGGGCCCGCGCGTGCTGGAAAAGTTTGGACCGCGATAG
Transcript >Hirsu2|2164
ATGGGAAACCCACCGCCTATCGTCCTCGACGGGGGAACTGGCTTCCTCAAGGTTGGCTATGCGGCGCAAAACTTC
CCCGAGCACCAGTACCCGTCGATCGTCGGGCGGCCGATCCTGCGATCCGAGGAGAAGACGGACAGCGATGTGATA
ATCAAGGACATCATGTGCGGCGACGAGGCGGCGGCCGCCCGAACCATGCTCCAGATCAGCTATCCCATGGAGAAC
GGCATCGTGAAGAAGTGGGACGACATGCAGTACCTCTGGGACTACACCTTCTTCGAGAAGCTCAAGGTCGATCCC
AGCGGGCAGAAGATCCTGCTGACGGAGCCACCCATGAACCCTCTCAAGAATCGGGAACAGATGTGCGAGGTCATG
TTTGACCGCTATGGCTTCGGCGGCGTCTACGTCGCCATCCAGGCGGTCCTGGCCTTGTACGCGCAGGGTCTCAGC
TCGGGTGTCGTGGTCGACTCGGGCGACGGCGTCACGCATATTGTCCCCGTATACGAGTCGGTGGTGCTGAACCAC
CTAACGAAGAGGCTGGACGTTGCCGGGCGCGACGTGACGCGCAACTTGATCAAGCTTCTCCTGCGCCGCGGCTAC
GCGCTGAACCGGACGGCCGACTTCGAGACGGTGCGGCAGATCAAGGAGAAGCTGTGCTACGTGTCGTACGACCTG
GAGCTGGACAAGCGGCTGAGCGAGGACACAACGGTGCTGGTGGAGAACTACACGCTGCCCGACGGGCGGGTGATC
CGGGTGGGCAGCGAGCGGTTCGAGGCGCCCGAGTGCCTGTTCCAGCCGCATCTGGTAGACAGCGAGTCGCCGGGG
CTGGGCGAGTTCCTCTTCAACACGATCCAGTCGGCCGACGTGGACATCCGGGCGTCGCTGTTCAAGGCGATCGTG
CTGTCGGGGGGCAGCAGCATGTACCCGGGGCTGCCGTCGCGGCTGGAGAAAGAGCTGAAGCAGCTGTGGCTGACG
CGGGCGTTGCAGGGCAACCCGGAGCGGCTGGGCAAGTTCAAGGTGCGGATAGAGGATCCGCCGCGGCGGAGACAT
ATGGTCTTCCTCGGGGGCGCGGTGCTGGCCAACATCATGGCCGACAACGAGAGCATGTGGGTGACTAAGGCGGAG
TGGGACGAGCAGGGCCCGCGCGTGCTGGAAAAGTTTGGACCGCGATAG
Gene >Hirsu2|2164
ATGGGAAACCCACCGCCTATCGGTATGCCACCTTACCTCTCCTCCCCCTTGCCGGGCCTCGTGAGCCTCGGCCCC
CGCCCGTACCGTCGGCCGGCCGCAGCGTCTCGACCCTCGATGATGGCATCGGCTGACACGTCCATCTCGCCGGCC
CGCAGTCCTCGACGGGGGAACTGGCTTCCTCAAGGTTGGCTATGCGGCGCAAAACTTCCCCGAGCACCAGTACCC
GTCGATCGTCGGGCGGCCGATCCTGCGATCCGAGGAGAAGACGGACAGCGATGTGATAATCAAGGACATCATGTG
CGGCGACGAGGCGGCGGCCGCCCGAACCATGCTCCAGATCAGCTATCCCATGGAGAACGGCATCGTGAAGAAGTG
GGACGACATGCAGTACCTCTGGGACTACACCTTCTTCGAGAAGCTCAAGGTCGATCCCAGCGGGCAGAAGATCCT
GCTGACGGAGCCACCCATGAACCCTCTCAAGAATCGGGAACAGATGTGCGAGGTCATGTTTGACCGCTATGGCTT
CGGCGGCGTCTACGTCGCCATCCAGGCGGTCCTGGCCTTGTACGCGCAGGGTGAGCCACCCGCCGACTGATCAGC
GGTCGAGCTTCCCCGCCGGGCCTTTCGCACGGGACTTGATACTTAACCGGTGTTGCCGCAGGTCTCAGCTCGGGT
GTCGTGGTCGACTCGGGCGACGGCGTCACGCATATTGTCCCCGTATACGAGTCGGTGGTGCTGAACCACCTAACG
AAGAGGCTGGACGTTGCCGGGCGCGACGTGACGCGCAACTTGATCAAGCTTCTCCTGCGCCGCGGCTACGCGCTG
AACCGGACGGCCGACTTCGAGACGGTGCGGCAGATCAAGGAGAAGCTGTGCTACGTGTCGTACGACCTGGAGCTG
GACAAGCGGCTGAGCGAGGACACAACGGTGCTGGTGGAGAACTACACGCTGCCCGACGGGCGGGTGATCCGGGTG
GGCAGCGAGCGGTTCGAGGCGCCCGAGTGCCTGTTCCAGCCGCATCTGGTAGACAGCGAGTCGCCGGGGCTGGGC
GAGTTCCTCTTCAACACGATCCAGTCGGCCGACGTGGACATCCGGGCGTCGCTGTTCAAGGCGATCGTGCTGTCG
GGGGGCAGCAGCATGTACCCGGGGCTGCCGTCGCGGCTGGAGAAAGAGCTGAAGCAGCTGTGGCTGACGCGGGCG
TTGCAGGGCAACCCGGAGCGGCTGGGCAAGTTCAAGGTGCGGATAGAGGATCCGCCGCGGCGGAGACATATGGTC
TTCCTCGGGGGCGCGGTGCTGGCCAACATCATGGCCGACAACGAGAGCATGTGGGTGACTAAGGCGGAGTGGGAC
GAGCAGGGCCCGCGCGTGCTGGAAAAGTTTGGACCGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail