Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2164
Gene name
LocationContig_150:20661..22053
Strand-
Gene length (bp)1392
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00022 Actin Actin 3.0E-102 6 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ1|ARP2_SCHPO Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 6 390 0.0E+00
sp|P32381|ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 6 390 0.0E+00
sp|P53487|ARP2_ACACA Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 7 386 0.0E+00
sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 7 388 0.0E+00
sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 7 388 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ1|ARP2_SCHPO Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 6 390 0.0E+00
sp|P32381|ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 6 390 0.0E+00
sp|P53487|ARP2_ACACA Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 7 386 0.0E+00
sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 7 388 0.0E+00
sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 7 388 0.0E+00
sp|Q7ZXV3|ARP2B_XENLA Actin-related protein 2-B OS=Xenopus laevis GN=actr2-b PE=2 SV=1 7 388 0.0E+00
sp|Q5M7U6|ARP2_RAT Actin-related protein 2 OS=Rattus norvegicus GN=Actr2 PE=2 SV=1 7 388 0.0E+00
sp|Q5R4K0|ARP2_PONAB Actin-related protein 2 OS=Pongo abelii GN=ACTR2 PE=2 SV=1 7 388 0.0E+00
sp|P61161|ARP2_MOUSE Actin-related protein 2 OS=Mus musculus GN=Actr2 PE=1 SV=1 7 388 0.0E+00
sp|P61160|ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens GN=ACTR2 PE=1 SV=1 7 388 0.0E+00
sp|A7MB62|ARP2_BOVIN Actin-related protein 2 OS=Bos taurus GN=ACTR2 PE=1 SV=1 7 388 0.0E+00
sp|Q5BL41|ARP2_XENTR Actin-related protein 2 OS=Xenopus tropicalis GN=actr2 PE=2 SV=1 7 388 0.0E+00
sp|Q7SXW6|ARP2A_DANRE Actin-related protein 2-A OS=Danio rerio GN=actr2a PE=2 SV=1 7 388 0.0E+00
sp|Q56A35|ARP2B_DANRE Actin-related protein 2-B OS=Danio rerio GN=actr2b PE=2 SV=1 7 388 0.0E+00
sp|P45888|ARP2_DROME Actin-related protein 2 OS=Drosophila melanogaster GN=Arp2 PE=2 SV=3 7 387 0.0E+00
sp|O96621|ARP2_DICDI Actin-related protein 2 OS=Dictyostelium discoideum GN=arpB PE=1 SV=1 1 387 0.0E+00
sp|P53489|ARP2_CAEEL Actin-related protein 2 OS=Caenorhabditis elegans GN=arx-2 PE=3 SV=1 7 388 0.0E+00
sp|Q61JZ2|ARP2_CAEBR Actin-related protein 2 OS=Caenorhabditis briggsae GN=arx-2 PE=3 SV=1 7 388 6.0E-178
sp|Q9LSD6|ARP2_ARATH Actin-related protein 2 OS=Arabidopsis thaliana GN=ARP2 PE=1 SV=1 1 387 1.0E-163
sp|Q6Z256|ARP2_ORYSJ Actin-related protein 2 OS=Oryza sativa subsp. japonica GN=ARP2 PE=3 SV=1 7 388 6.0E-162
sp|A2YUL5|ARP2_ORYSI Actin-related protein 2 OS=Oryza sativa subsp. indica GN=ARP2 PE=3 SV=2 7 388 1.0E-161
sp|P0C540|ACT7_ORYSJ Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE=3 SV=1 6 385 6.0E-121
sp|P0C542|ACT7_ORYSI Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3 SV=1 6 385 6.0E-121
sp|P53492|ACT7_ARATH Actin-7 OS=Arabidopsis thaliana GN=ACT7 PE=1 SV=1 6 386 2.0E-120
sp|P0CJ47|ACT3_ARATH Actin-3 OS=Arabidopsis thaliana GN=ACT3 PE=1 SV=1 6 386 8.0E-120
sp|P0CJ46|ACT1_ARATH Actin-1 OS=Arabidopsis thaliana GN=ACT1 PE=1 SV=1 6 386 8.0E-120
sp|P02578|ACT1_ACACA Actin-1 OS=Acanthamoeba castellanii PE=1 SV=1 7 386 1.0E-119
sp|Q10AZ4|ACT3_ORYSJ Actin-3 OS=Oryza sativa subsp. japonica GN=ACT3 PE=2 SV=1 6 386 3.0E-119
sp|A2XNS1|ACT3_ORYSI Actin-3 OS=Oryza sativa subsp. indica GN=ACT3 PE=3 SV=2 6 386 3.0E-119
sp|P53459|ACT6_DIPDE Actin-6 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT6 PE=2 SV=1 6 386 3.0E-119
sp|Q05214|ACT1_TOBAC Actin OS=Nicotiana tabacum PE=3 SV=1 6 386 4.0E-119
sp|O18499|ACT1_SACKO Actin-1 OS=Saccoglossus kowalevskii PE=2 SV=1 7 386 5.0E-119
sp|Q0PGG4|ACTB_BOSMU Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACTB PE=2 SV=1 7 386 5.0E-119
sp|A3C6D7|ACT2_ORYSJ Actin-2 OS=Oryza sativa subsp. japonica GN=ACT2 PE=2 SV=1 6 386 6.0E-119
sp|P0C539|ACT2_ORYSI Actin-2 OS=Oryza sativa subsp. indica GN=ACT2 PE=3 SV=1 6 386 6.0E-119
sp|P53458|ACT5_DIPDE Actin-5 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT5 PE=2 SV=1 7 386 7.0E-119
sp|P53485|ACTB2_TAKRU Actin, cytoplasmic 2 OS=Takifugu rubripes GN=actbb PE=3 SV=1 7 386 7.0E-119
sp|P10365|ACT_THELA Actin OS=Thermomyces lanuginosus PE=3 SV=1 7 386 7.0E-119
sp|O18500|ACT2_SACKO Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1 7 386 7.0E-119
sp|A2BDB0|ACTG_XENLA Actin, cytoplasmic 2 OS=Xenopus laevis GN=actg1 PE=2 SV=1 7 386 9.0E-119
sp|P63257|ACTG_TRIVU Actin, cytoplasmic 2 OS=Trichosurus vulpecula GN=ACTG1 PE=2 SV=1 7 386 9.0E-119
sp|P63259|ACTG_RAT Actin, cytoplasmic 2 OS=Rattus norvegicus GN=Actg1 PE=1 SV=1 7 386 9.0E-119
sp|P63260|ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus GN=Actg1 PE=1 SV=1 7 386 9.0E-119
sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens GN=ACTG1 PE=1 SV=1 7 386 9.0E-119
sp|Q5ZMQ2|ACTG_CHICK Actin, cytoplasmic 2 OS=Gallus gallus GN=ACTG1 PE=1 SV=1 7 386 9.0E-119
sp|P63258|ACTG_BOVIN Actin, cytoplasmic 2 OS=Bos taurus GN=ACTG1 PE=1 SV=1 7 386 9.0E-119
sp|P35432|ACT1_ECHGR Actin-1 OS=Echinococcus granulosus GN=ACTI PE=3 SV=1 6 386 9.0E-119
sp|P53505|ACT5_XENLA Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1 7 386 1.0E-118
sp|Q5JAK2|ACTG_PELLE Actin, cytoplasmic 2 OS=Pelophylax lessonae GN=actg1 PE=2 SV=1 7 386 1.0E-118
sp|P48975|ACTB_CRIGR Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB PE=3 SV=1 7 386 1.0E-118
sp|P15475|ACTB_XENBO Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb PE=3 SV=1 7 386 1.0E-118
sp|P11426|ACT_ENTHI Actin OS=Entamoeba histolytica PE=2 SV=1 7 386 1.0E-118
sp|P29751|ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus GN=ACTB PE=2 SV=1 7 386 1.0E-118
sp|P84336|ACTB_CAMDR Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1 7 386 1.0E-118
sp|Q8JJB8|ACTG_TRISC Actin, cytoplasmic 2 OS=Triakis scyllium GN=actg1 PE=2 SV=1 7 386 1.0E-118
sp|P60707|ACTB_TRIVU Actin, cytoplasmic 1 OS=Trichosurus vulpecula GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|Q4L0Y2|ACTB_SPECI Actin, cytoplasmic 1 OS=Spermophilus citellus GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60713|ACTB_SHEEP Actin, cytoplasmic 1 OS=Ovis aries GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60711|ACTB_RAT Actin, cytoplasmic 1 OS=Rattus norvegicus GN=Actb PE=1 SV=1 7 386 2.0E-118
sp|Q5R6G0|ACTB_PONAB Actin, cytoplasmic 1 OS=Pongo abelii GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|Q6QAQ1|ACTB_PIG Actin, cytoplasmic 1 OS=Sus scrofa GN=ACTB PE=1 SV=2 7 386 2.0E-118
sp|Q5R1X3|ACTB_PANTR Actin, cytoplasmic 1 OS=Pan troglodytes GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60710|ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus GN=Actb PE=1 SV=1 7 386 2.0E-118
sp|Q711N9|ACTB_MESAU Actin, cytoplasmic 1 OS=Mesocricetus auratus GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|Q4R561|ACTB_MACFA Actin, cytoplasmic 1 OS=Macaca fascicularis GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|P60708|ACTB_HORSE Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|Q76N69|ACTB_CHLAE Actin, cytoplasmic 1 OS=Chlorocebus aethiops GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|P60706|ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|Q71FK5|ACTB_CAVPO Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE=2 SV=1 7 386 2.0E-118
sp|O18840|ACTB_CANLF Actin, cytoplasmic 1 OS=Canis lupus familiaris GN=ACTB PE=2 SV=3 7 386 2.0E-118
sp|P60712|ACTB_BOVIN Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV=1 7 386 2.0E-118
sp|Q6P378|ACTG_XENTR Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg1 PE=2 SV=1 7 386 2.0E-118
sp|Q7ZVI7|ACTB1_DANRE Actin, cytoplasmic 1 OS=Danio rerio GN=actba PE=2 SV=2 7 386 2.0E-118
sp|P83750|ACTB_CYPCA Actin, cytoplasmic 1 OS=Cyprinus carpio GN=actb PE=3 SV=1 7 386 2.0E-118
sp|P83751|ACTB_CTEID Actin, cytoplasmic 1 OS=Ctenopharyngodon idella GN=actb PE=3 SV=1 7 386 2.0E-118
sp|Q7ZVF9|ACTB2_DANRE Actin, cytoplasmic 2 OS=Danio rerio GN=actbb PE=2 SV=2 7 386 2.0E-118
sp|O65315|ACT_COLSC Actin OS=Coleochaete scutata PE=2 SV=1 7 386 3.0E-118
sp|P30167|ACT3_SOLTU Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1 6 386 3.0E-118
sp|P53478|ACT5_CHICK Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV=1 7 386 3.0E-118
sp|P53470|ACT1_SCHMA Actin-1 OS=Schistosoma mansoni PE=2 SV=1 7 386 3.0E-118
sp|P30163|ACT2_ONCVO Actin-2 OS=Onchocerca volvulus GN=act-2b PE=3 SV=1 7 386 3.0E-118
sp|P53472|ACTA_STRPU Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus GN=CYIA PE=3 SV=1 7 386 3.0E-118
sp|P30171|ACT11_SOLTU Actin-97 OS=Solanum tuberosum GN=AC97 PE=3 SV=1 6 386 4.0E-118
sp|P10986|ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=3 SV=2 7 386 4.0E-118
sp|P45886|ACT3_BACDO Actin-3, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 7 386 4.0E-118
sp|P53467|ACTM_MOLOC Actin, larval muscle-type OS=Molgula oculata PE=3 SV=1 7 386 4.0E-118
sp|P07837|ACT2_BOMMO Actin, muscle-type A2 OS=Bombyx mori PE=3 SV=1 7 386 4.0E-118
sp|P69005|ACTD_STRPU Actin, cytoskeletal 2B OS=Strongylocentrotus purpuratus GN=CYIIB PE=2 SV=1 7 386 4.0E-118
sp|P69004|ACT2_STRFN Actin-15B OS=Strongylocentrotus franciscanus PE=2 SV=1 7 386 4.0E-118
sp|P10984|ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 7 386 4.0E-118
sp|P30162|ACT1_ONCVO Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1 7 386 4.0E-118
sp|O81221|ACT_GOSHI Actin OS=Gossypium hirsutum PE=3 SV=1 6 386 5.0E-118
sp|P69003|ACT1_HELTB Actin CyI, cytoplasmic OS=Heliocidaris tuberculata PE=3 SV=1 7 386 5.0E-118
sp|P69002|ACT1_HELER Actin CyI, cytoplasmic OS=Heliocidaris erythrogramma PE=3 SV=1 7 386 5.0E-118
sp|P45885|ACT2_BACDO Actin-2, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 7 386 5.0E-118
sp|Q6NVA9|ACTB_XENTR Actin, cytoplasmic 1 OS=Xenopus tropicalis GN=actb PE=2 SV=1 7 386 5.0E-118
sp|O93400|ACTB_XENLA Actin, cytoplasmic 1 OS=Xenopus laevis GN=actb PE=2 SV=1 7 386 5.0E-118
sp|P18603|ACT4_ARTSX Actin, clone 403 OS=Artemia sp. PE=2 SV=1 7 386 5.0E-118
sp|P30173|ACT13_SOLTU Actin-101 OS=Solanum tuberosum GN=AC101 PE=3 SV=1 6 386 5.0E-118
sp|O42161|ACTB_SALSA Actin, cytoplasmic 1 OS=Salmo salar GN=actb PE=2 SV=1 7 386 6.0E-118
sp|P53473|ACTB_STRPU Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus GN=CYIB PE=3 SV=1 7 386 6.0E-118
sp|P49128|ACT1_AEDAE Actin-1 OS=Aedes aegypti GN=ACT-1 PE=2 SV=2 7 386 6.0E-118
sp|P10990|ACT1_STRFN Actin-15A OS=Strongylocentrotus franciscanus PE=3 SV=1 7 386 6.0E-118
sp|Q91ZK5|ACTB_SIGHI Actin, cytoplasmic 1 OS=Sigmodon hispidus GN=ACTB PE=2 SV=1 7 386 7.0E-118
sp|P18600|ACT1_ARTSX Actin, clone 205 OS=Artemia sp. PE=2 SV=1 7 386 7.0E-118
sp|P53501|ACT3_DROME Actin-57B OS=Drosophila melanogaster GN=Act57B PE=1 SV=1 7 386 8.0E-118
sp|Q964E1|ACTC_BIOOB Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 SV=1 7 386 8.0E-118
sp|P0DM42|ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans GN=act-3 PE=1 SV=1 7 386 8.0E-118
sp|P0DM41|ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans GN=act-1 PE=1 SV=1 7 386 8.0E-118
sp|P68143|ACTB_OREMO Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1 7 386 8.0E-118
sp|P68142|ACTB1_TAKRU Actin, cytoplasmic 1 OS=Takifugu rubripes GN=actba PE=2 SV=1 7 386 8.0E-118
sp|P10981|ACT5_DROME Actin-87E OS=Drosophila melanogaster GN=Act87E PE=1 SV=1 7 386 9.0E-118
sp|P53464|ACTM_HELTB Actin, cytoskeletal OS=Heliocidaris tuberculata PE=3 SV=1 7 386 9.0E-118
sp|P63256|ACTG_ANSAN Actin, cytoplasmic 2 OS=Anser anser anser GN=ACTG1 PE=2 SV=1 7 386 1.0E-117
sp|Q964D9|ACTC_PLATR Actin, cytoplasmic OS=Planorbella trivolvis PE=3 SV=1 7 386 1.0E-117
sp|P53498|ACT_CHLRE Actin OS=Chlamydomonas reinhardtii PE=2 SV=1 2 386 1.0E-117
sp|P53506|ACT8_XENLA Actin, cytoplasmic type 8 OS=Xenopus laevis PE=3 SV=1 7 386 1.0E-117
sp|Q964E3|ACTC_BIOAL Actin, cytoplasmic OS=Biomphalaria alexandrina PE=3 SV=1 7 386 1.0E-117
sp|P79818|ACTB_ORYLA Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE=2 SV=2 7 386 2.0E-117
sp|P53463|ACTM_HELER Actin, cytoskeletal OS=Heliocidaris erythrogramma PE=3 SV=1 7 386 2.0E-117
sp|Q964E0|ACTC_BIOTE Actin, cytoplasmic OS=Biomphalaria tenagophila PE=3 SV=1 7 386 2.0E-117
sp|Q8X119|ACT_EXODE Actin OS=Exophiala dermatitidis PE=3 SV=1 7 386 2.0E-117
sp|Q964E2|ACTC_BIOPF Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1 7 386 2.0E-117
sp|P68555|ACT_TAESO Actin OS=Taenia solium GN=ACT1 PE=3 SV=1 7 386 2.0E-117
sp|P68556|ACT1_DIPDE Actin-1/4 OS=Diphyllobothrium dendriticum GN=ACT1 PE=2 SV=1 7 386 2.0E-117
sp|P46258|ACT3_PEA Actin-3 OS=Pisum sativum PE=2 SV=1 6 386 2.0E-117
sp|P53486|ACTB3_TAKRU Actin, cytoplasmic 3 OS=Takifugu rubripes GN=actbc PE=2 SV=1 7 386 2.0E-117
sp|Q26065|ACT_PLAMG Actin, adductor muscle OS=Placopecten magellanicus PE=2 SV=1 7 386 2.0E-117
sp|P53471|ACT2_SCHMA Actin-2 OS=Schistosoma mansoni PE=2 SV=1 7 386 2.0E-117
sp|P83968|ACT6_DROSI Actin, indirect flight muscle OS=Drosophila simulans GN=Act88F PE=3 SV=1 7 386 3.0E-117
sp|P83967|ACT6_DROME Actin, indirect flight muscle OS=Drosophila melanogaster GN=Act88F PE=1 SV=1 7 386 3.0E-117
sp|P83969|ACT1_BACDO Actin, indirect flight muscle OS=Bactrocera dorsalis PE=3 SV=1 7 386 3.0E-117
sp|P04829|ACT3_BOMMO Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3 7 386 3.0E-117
sp|P02576|ACTA_PHYPO Actin, plasmodial isoform OS=Physarum polycephalum GN=ARDA PE=1 SV=2 7 386 3.0E-117
sp|O65314|ACT_SCHDU Actin OS=Scherffelia dubia PE=2 SV=1 2 386 3.0E-117
sp|Q553U6|ACT22_DICDI Putative actin-22 OS=Dictyostelium discoideum GN=act22 PE=3 SV=1 7 386 3.0E-117
sp|Q00215|ACTC_STYPL Actin, cytoplasmic OS=Styela plicata PE=3 SV=1 7 386 4.0E-117
sp|P92179|ACTC_BIOGL Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 SV=2 7 386 4.0E-117
sp|P12716|ACTC_PISOC Actin, cytoplasmic OS=Pisaster ochraceus PE=3 SV=1 7 386 4.0E-117
sp|Q25010|ACT3A_HELAM Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=actA3a PE=2 SV=1 7 386 4.0E-117
sp|P53457|ACT3_DIPDE Actin-3 OS=Diphyllobothrium dendriticum GN=ACT3 PE=2 SV=1 7 386 4.0E-117
sp|P10989|ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act1 PE=1 SV=1 7 384 4.0E-117
sp|P53496|ACT11_ARATH Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=1 6 386 4.0E-117
sp|P84185|ACT5C_ANOGA Actin-5C OS=Anopheles gambiae GN=Act5C PE=2 SV=1 7 386 4.0E-117
sp|P84183|ACT4_BOMMO Actin, cytoplasmic A4 OS=Bombyx mori GN=A4 PE=2 SV=1 7 386 4.0E-117
sp|P84184|ACT3B_HELAM Actin-A3b, cytoplasmic OS=Helicoverpa armigera GN=actA3b PE=2 SV=1 7 386 4.0E-117
sp|P10987|ACT1_DROME Actin-5C OS=Drosophila melanogaster GN=Act5C PE=1 SV=4 7 386 4.0E-117
sp|Q9Y707|ACT2_SUIBO Actin-2 OS=Suillus bovinus GN=ACT2 PE=2 SV=1 7 386 4.0E-117
sp|P53460|ACT1_HALRO Actin, muscle 1A OS=Halocynthia roretzi GN=MA1A PE=3 SV=1 7 386 4.0E-117
sp|P49871|ACT_MANSE Actin, muscle OS=Manduca sexta PE=2 SV=1 7 386 5.0E-117
sp|P53456|ACT2_DIPDE Actin-2 OS=Diphyllobothrium dendriticum GN=ACT2 PE=2 SV=1 7 386 5.0E-117
sp|P02572|ACT2_DROME Actin-42A OS=Drosophila melanogaster GN=Act42A PE=1 SV=3 7 386 5.0E-117
sp|P41339|ACTA_LIMPO Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1 7 386 5.0E-117
sp|P17304|ACTM_APLCA Actin, muscle OS=Aplysia californica PE=2 SV=1 7 386 5.0E-117
sp|P78711|ACT_NEUCR Actin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=act PE=3 SV=2 7 386 5.0E-117
sp|Q6TCF2|ACT_GAEGA Actin OS=Gaeumannomyces graminis var. avenae GN=ACT PE=2 SV=1 7 386 5.0E-117
sp|Q9UVW9|ACTG_ACRCH Actin, gamma OS=Acremonium chrysogenum GN=ACT PE=3 SV=1 7 386 5.0E-117
sp|P41340|ACT3_LIMPO Actin-3 OS=Limulus polyphemus PE=1 SV=1 7 386 5.0E-117
sp|P20904|ACT_VOLCA Actin OS=Volvox carteri PE=3 SV=1 2 386 6.0E-117
sp|O16808|ACT_MAYDE Actin OS=Mayetiola destructor PE=2 SV=1 7 386 7.0E-117
sp|Q93131|ACTC_BRAFL Actin, cytoplasmic OS=Branchiostoma floridae PE=2 SV=1 7 386 7.0E-117
sp|P10995|ACT2_XENLA Actin, alpha skeletal muscle 2 OS=Xenopus laevis GN=act2 PE=2 SV=1 7 386 7.0E-117
sp|P20399|ACT2_XENTR Actin, alpha cardiac muscle 2 OS=Xenopus tropicalis PE=2 SV=1 7 386 7.0E-117
sp|P53494|ACT4_ARATH Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1 6 386 7.0E-117
sp|P20359|ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acnA PE=3 SV=2 7 386 8.0E-117
sp|Q93129|ACTC_BRABE Actin, cytoplasmic OS=Branchiostoma belcheri PE=2 SV=1 7 386 8.0E-117
sp|P53689|ACT_PHARH Actin OS=Phaffia rhodozyma PE=3 SV=1 7 386 8.0E-117
sp|O17320|ACT_CRAGI Actin OS=Crassostrea gigas PE=2 SV=1 7 386 9.0E-117
sp|P07836|ACT1_BOMMO Actin, muscle-type A1 OS=Bombyx mori PE=3 SV=1 7 386 9.0E-117
sp|Q54GX7|ACT10_DICDI Actin-10 OS=Dictyostelium discoideum GN=act10 PE=1 SV=1 7 386 1.0E-116
sp|P04751|ACTC_XENLA Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN=actc1 PE=2 SV=1 7 386 1.0E-116
sp|P02582|ACT1_MAIZE Actin-1 OS=Zea mays GN=ACT1 PE=3 SV=1 6 385 1.0E-116
sp|P07830|ACT1_DICDI Major actin OS=Dictyostelium discoideum GN=act1 PE=1 SV=2 7 386 1.0E-116
sp|Q25472|ACT2_MOLOC Actin, muscle-type OS=Molgula oculata PE=3 SV=1 7 386 1.0E-116
sp|P53455|ACT_AJECG Actin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_08711 PE=2 SV=2 7 386 1.0E-116
sp|P53479|ACTS_CYPCA Actin, alpha skeletal muscle OS=Cyprinus carpio GN=acta1 PE=2 SV=1 7 386 1.0E-116
sp|P53497|ACT12_ARATH Actin-12 OS=Arabidopsis thaliana GN=ACT12 PE=1 SV=1 6 386 1.0E-116
sp|P91754|ACT_LUMRU Actin (Fragment) OS=Lumbricus rubellus PE=2 SV=1 7 386 1.0E-116
sp|P49055|ACTS_CARAU Actin, alpha skeletal muscle OS=Carassius auratus GN=acta1 PE=2 SV=1 7 386 1.0E-116
sp|P41341|ACTY_LIMPO Actin-11 OS=Limulus polyphemus PE=2 SV=1 7 386 1.0E-116
sp|P68136|ACTS_RAT Actin, alpha skeletal muscle OS=Rattus norvegicus GN=Acta1 PE=1 SV=1 7 386 1.0E-116
sp|P68135|ACTS_RABIT Actin, alpha skeletal muscle OS=Oryctolagus cuniculus GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|Q5R9Q5|ACTS_PONAB Actin, alpha skeletal muscle OS=Pongo abelii GN=ACTA1 PE=2 SV=1 7 386 1.0E-116
sp|P68137|ACTS_PIG Actin, alpha skeletal muscle OS=Sus scrofa GN=ACTA1 PE=3 SV=1 7 386 1.0E-116
sp|P68134|ACTS_MOUSE Actin, alpha skeletal muscle OS=Mus musculus GN=Acta1 PE=1 SV=1 7 386 1.0E-116
sp|P68133|ACTS_HUMAN Actin, alpha skeletal muscle OS=Homo sapiens GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|P68139|ACTS_CHICK Actin, alpha skeletal muscle OS=Gallus gallus GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|P68138|ACTS_BOVIN Actin, alpha skeletal muscle OS=Bos taurus GN=ACTA1 PE=1 SV=1 7 386 1.0E-116
sp|O15998|ACTM_CIOSA Actin, muscle OS=Ciona savignyi PE=2 SV=1 7 386 1.0E-116
sp|P43239|ACT1_PNECA Actin-1 OS=Pneumocystis carinii PE=2 SV=1 7 384 1.0E-116
sp|O13419|ACT_BOTFU Actin OS=Botryotinia fuckeliana GN=actA PE=3 SV=1 7 386 2.0E-116
sp|Q9Y702|ACT1_SCHCO Actin-1 OS=Schizophyllum commune GN=ACT1 PE=2 SV=1 7 386 2.0E-116
sp|P30164|ACT1_PEA Actin-1 OS=Pisum sativum PE=2 SV=1 6 386 2.0E-116
sp|P92182|ACT1_LUMTE Actin-1 OS=Lumbricus terrestris GN=ACT1 PE=2 SV=1 7 386 2.0E-116
sp|Q9URS0|ACTG_PENCH Actin, gamma OS=Penicillium chrysogenum GN=ACT PE=3 SV=1 7 386 2.0E-116
sp|P53474|ACTE_STRPU Actin, cytoskeletal 3A OS=Strongylocentrotus purpuratus GN=CYIIIA PE=3 SV=1 7 386 2.0E-116
sp|P27130|ACT2_HALRO Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2 PE=2 SV=1 7 386 2.0E-116
sp|P27131|ACT1_NAEFO Actin-1 OS=Naegleria fowleri PE=2 SV=2 7 386 2.0E-116
sp|P18601|ACT2_ARTSX Actin, clone 211 OS=Artemia sp. PE=2 SV=1 7 386 2.0E-116
sp|Q6P640|ACTC_XENTR Actin, alpha cardiac muscle 1 OS=Xenopus tropicalis GN=actc1 PE=2 SV=1 7 386 2.0E-116
sp|P68035|ACTC_RAT Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=2 SV=1 7 386 2.0E-116
sp|P68033|ACTC_MOUSE Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1 7 386 2.0E-116
sp|P68032|ACTC_HUMAN Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1 7 386 2.0E-116
sp|P68034|ACTC_CHICK Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=ACTC1 PE=3 SV=1 7 386 2.0E-116
sp|Q3ZC07|ACTC_BOVIN Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACTC1 PE=2 SV=1 7 386 2.0E-116
sp|P53480|ACTC_TAKRU Actin, alpha cardiac OS=Takifugu rubripes PE=2 SV=1 7 386 2.0E-116
sp|Q10DV7|ACT1_ORYSJ Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE=2 SV=1 6 386 2.0E-116
sp|A2XLF2|ACT1_ORYSI Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2 SV=1 6 386 2.0E-116
sp|P26197|ACT2_ABSGL Actin-2 OS=Absidia glauca GN=ACT2 PE=3 SV=1 7 386 2.0E-116
sp|Q07903|ACTC_STRPU Actin, cytoskeletal 2A OS=Strongylocentrotus purpuratus GN=CYIIA PE=2 SV=1 7 386 2.0E-116
sp|P02574|ACT4_DROME Actin, larval muscle OS=Drosophila melanogaster GN=Act79B PE=1 SV=2 7 386 2.0E-116
sp|P12717|ACTM_PISOC Actin, muscle OS=Pisaster ochraceus PE=3 SV=1 7 386 3.0E-116
sp|P30165|ACT2_PEA Actin-2 OS=Pisum sativum PE=2 SV=1 6 386 3.0E-116
sp|Q96292|ACT2_ARATH Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1 6 386 3.0E-116
sp|P26183|ACT_CRYPV Actin OS=Cryptosporidium parvum PE=3 SV=1 7 386 4.0E-116
sp|P68264|ACTS_OREMO Actin, alpha skeletal muscle OS=Oreochromis mossambicus GN=acta1 PE=2 SV=1 7 386 4.0E-116
sp|P68140|ACTSA_TAKRU Actin, alpha skeletal muscle A OS=Takifugu rubripes GN=acta1a PE=2 SV=1 7 386 4.0E-116
sp|Q98972|ACTS_ORYLA Actin, alpha skeletal muscle OS=Oryzias latipes GN=acta1 PE=2 SV=1 7 386 4.0E-116
sp|Q96293|ACT8_ARATH Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2 6 386 4.0E-116
sp|P17126|ACT_HYDVU Actin, non-muscle 6.2 OS=Hydra vulgaris PE=3 SV=1 7 386 4.0E-116
sp|Q90X97|ACTS_ATRMM Actin, alpha skeletal muscle OS=Atractaspis microlepidota microlepidota GN=ACTA1 PE=2 SV=1 7 386 5.0E-116
sp|P48465|ACT_CRYNH Actin OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_00483 PE=3 SV=2 7 386 5.0E-116
sp|P90689|ACT_BRUMA Actin OS=Brugia malayi PE=1 SV=1 7 386 5.0E-116
sp|P45887|ACT5_BACDO Actin-5, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 7 386 6.0E-116
sp|Q9BYX7|ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens GN=POTEKP PE=5 SV=1 7 386 6.0E-116
sp|Q2U7A3|ACT_ASPOR Actin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=act1 PE=3 SV=1 7 386 8.0E-116
sp|P04752|ACT3_XENLA Actin, alpha skeletal muscle 3 OS=Xenopus laevis GN=act3 PE=2 SV=2 7 386 8.0E-116
sp|Q8RYC2|ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana GN=ACT5 PE=5 SV=1 7 386 9.0E-116
sp|P62738|ACTA_RAT Actin, aortic smooth muscle OS=Rattus norvegicus GN=Acta2 PE=2 SV=1 7 386 1.0E-115
sp|P62740|ACTA_RABIT Actin, aortic smooth muscle OS=Oryctolagus cuniculus GN=ACTA2 PE=2 SV=1 7 386 1.0E-115
sp|P62737|ACTA_MOUSE Actin, aortic smooth muscle OS=Mus musculus GN=Acta2 PE=1 SV=1 7 386 1.0E-115
sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1 7 386 1.0E-115
sp|P62739|ACTA_BOVIN Actin, aortic smooth muscle OS=Bos taurus GN=ACTA2 PE=1 SV=1 7 386 1.0E-115
sp|O17503|ACTC_BRALA Actin, cytoplasmic OS=Branchiostoma lanceolatum PE=2 SV=1 7 386 1.0E-115
sp|Q03341|ACT2_ECHGR Actin-2 OS=Echinococcus granulosus GN=ACTII PE=3 SV=1 7 386 1.0E-115
sp|P30168|ACT6_SOLTU Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2 6 386 1.0E-115
sp|P63269|ACTH_RAT Actin, gamma-enteric smooth muscle OS=Rattus norvegicus GN=Actg2 PE=2 SV=1 7 386 1.0E-115
sp|P63268|ACTH_MOUSE Actin, gamma-enteric smooth muscle OS=Mus musculus GN=Actg2 PE=1 SV=1 7 386 1.0E-115
sp|P63267|ACTH_HUMAN Actin, gamma-enteric smooth muscle OS=Homo sapiens GN=ACTG2 PE=1 SV=1 7 386 1.0E-115
sp|P63270|ACTH_CHICK Actin, gamma-enteric smooth muscle OS=Gallus gallus GN=ACTG2 PE=1 SV=1 7 386 1.0E-115
sp|Q5E9B5|ACTH_BOVIN Actin, gamma-enteric smooth muscle OS=Bos taurus GN=ACTG2 PE=2 SV=1 7 386 1.0E-115
sp|P53482|ACTSB_TAKRU Actin, alpha skeletal muscle B OS=Takifugu rubripes GN=acta1b PE=2 SV=1 7 386 1.0E-115
sp|P07829|ACT3_DICDI Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 SV=3 7 386 1.0E-115
sp|P08023|ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus GN=ACTA2 PE=1 SV=2 7 386 2.0E-115
sp|P53475|ACTN_STYCL Actin, muscle OS=Styela clava GN=TB12 PE=2 SV=1 7 386 2.0E-115
sp|P53461|ACTC_HALRO Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=3 SV=1 7 386 2.0E-115
sp|Q75D00|ACT_ASHGO Actin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACT1 PE=2 SV=1 2 385 2.0E-115
sp|P60010|ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1 7 385 2.0E-115
sp|P60011|ACT_SACBA Actin OS=Saccharomyces bayanus GN=ACT1 PE=3 SV=1 7 385 2.0E-115
sp|P60009|ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACT1 PE=3 SV=1 7 385 2.0E-115
sp|Q9NJV4|ACT1_NAEGR Actin-1 OS=Naegleria gruberi GN=ACT1 PE=3 SV=1 7 386 2.0E-115
sp|P17128|ACT_KLULA Actin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACT PE=3 SV=2 7 385 2.0E-115
sp|P41112|ACT1_PODCA Actin-1/2 OS=Podocoryna carnea GN=ACTIA PE=2 SV=1 7 386 3.0E-115
sp|P41113|ACT3_PODCA Actin-3 OS=Podocoryna carnea GN=ACT3 PE=3 SV=1 7 386 3.0E-115
sp|Q9UVF3|ACT_YARLI Actin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ACT1 PE=3 SV=2 7 386 3.0E-115
sp|P50138|ACT_PUCGR Actin OS=Puccinia graminis PE=3 SV=1 7 386 3.0E-115
sp|P53465|ACT1_LYTPI Actin, cytoskeletal 1 OS=Lytechinus pictus PE=2 SV=1 7 386 3.0E-115
sp|Q6P8G3|ACT3_XENTR Actin, alpha sarcomeric/skeletal OS=Xenopus tropicalis GN=act3 PE=2 SV=1 7 386 3.0E-115
sp|Q39758|ACT_FUCVE Actin OS=Fucus vesiculosus PE=2 SV=1 7 386 5.0E-115
sp|P92176|ACT2_LUMTE Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1 7 386 5.0E-115
sp|P26198|ACTM_STYCL Actin, muscle OS=Styela clava PE=2 SV=1 7 386 5.0E-115
sp|Q8BFZ3|ACTBL_MOUSE Beta-actin-like protein 2 OS=Mus musculus GN=Actbl2 PE=1 SV=1 7 386 5.0E-115
sp|O65316|ACT_MESVI Actin OS=Mesostigma viride PE=3 SV=1 2 386 7.0E-115
sp|Q9Y701|ACT1_SUIBO Actin-1 OS=Suillus bovinus GN=ACT1 PE=2 SV=1 7 386 2.0E-114
sp|P18499|ACTF_STRPU Actin, cytoskeletal 3B OS=Strongylocentrotus purpuratus GN=CYIIIB PE=2 SV=1 7 386 2.0E-114
sp|Q9P4D1|ACT_PICPG Actin OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ACT1 PE=1 SV=1 7 385 4.0E-114
sp|P53466|ACT2_LYTPI Actin, cytoskeletal 2 OS=Lytechinus pictus PE=2 SV=1 7 386 4.0E-114
sp|Q562R1|ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 7 386 7.0E-114
sp|P26182|ACT_ACHBI Actin OS=Achlya bisexualis PE=3 SV=1 7 386 1.0E-113
sp|Q9UVZ8|ACT_CANDC Actin OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ACT1 PE=3 SV=1 7 385 1.0E-113
sp|P22131|ACT1_PHYIN Actin-1 OS=Phytophthora infestans GN=ACTA PE=2 SV=1 7 386 1.0E-113
sp|P53476|ACT_TOXGO Actin OS=Toxoplasma gondii GN=ACT1 PE=3 SV=1 7 386 1.0E-113
sp|P14235|ACT_CANAX Actin OS=Candida albicans GN=ACT1 PE=3 SV=1 7 385 2.0E-113
sp|Q9Y896|ACT2_SCHCO Actin-2 OS=Schizophyllum commune GN=ACT2 PE=3 SV=1 7 386 3.0E-113
sp|P12432|ACT1_TRYBB Actin A OS=Trypanosoma brucei brucei PE=3 SV=1 7 385 4.0E-113
sp|O74258|ACT_OGAPD Actin OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=ACT PE=3 SV=2 7 385 5.0E-113
sp|Q7RME1|ACT1_PLAYO Actin-1 OS=Plasmodium yoelii yoelii GN=PY02240 PE=3 SV=1 7 386 6.0E-113
sp|P86287|ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) PE=1 SV=1 7 386 9.0E-113
sp|Q8I4X0|ACT1_PLAF7 Actin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PFL2215w PE=3 SV=1 7 386 9.0E-113
sp|P53504|ACT1_SORBI Actin-1 OS=Sorghum bicolor GN=AC1 PE=2 SV=1 6 386 1.0E-112
sp|Q9UVX4|ACT_COPC7 Actin OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACT1 PE=3 SV=1 7 386 1.0E-112
sp|P10988|ACT1_PLAFO Actin-1 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 7 386 2.0E-112
sp|P22132|ACT2_PHYIN Actin-2 OS=Phytophthora infestans GN=ACTB PE=2 SV=1 7 386 2.0E-112
sp|P53500|ACT_CYAME Actin OS=Cyanidioschyzon merolae PE=3 SV=1 7 386 3.0E-112
sp|P30172|ACT12_SOLTU Actin-100 (Fragment) OS=Solanum tuberosum GN=AC100 PE=3 SV=1 19 386 3.0E-112
sp|P13363|ACT_PHYME Actin OS=Phytophthora megasperma PE=3 SV=1 7 386 1.0E-111
sp|P84856|ACTB_CHLPG Actin, cytoplasmic 1 OS=Chlorocebus pygerythrus GN=ACTB PE=1 SV=1 17 386 1.0E-111
sp|Q00214|ACTM_STYPL Actin, muscle OS=Styela plicata PE=3 SV=1 7 386 2.0E-111
sp|P07828|ACT18_DICDI Actin-18 OS=Dictyostelium discoideum GN=act18 PE=3 SV=3 7 386 4.0E-111
sp|P12433|ACT2_TRYBB Actin B OS=Trypanosoma brucei brucei PE=3 SV=1 7 385 5.0E-111
sp|P53502|ACT_FUCDI Actin OS=Fucus distichus PE=2 SV=1 7 386 7.0E-111
sp|P53499|ACT_CHOCR Actin OS=Chondrus crispus GN=AC PE=2 SV=1 5 386 2.0E-110
sp|Q93132|ACTM_BRAFL Actin, muscle OS=Branchiostoma floridae PE=2 SV=1 6 386 2.0E-110
sp|P86288|ACT2_PLAFX Actin-2 OS=Plasmodium falciparum (isolate HB3) PE=3 SV=1 7 386 2.0E-110
sp|Q8ILW9|ACT2_PLAF7 Actin-2 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0124 PE=3 SV=1 7 386 2.0E-110
sp|O17502|ACTM_BRALA Actin, muscle OS=Branchiostoma lanceolatum PE=2 SV=1 6 386 3.0E-110
sp|Q93130|ACTM_BRABE Actin, muscle OS=Branchiostoma belcheri PE=2 SV=1 6 386 5.0E-110
sp|Q4Z1L3|ACT1_PLABA Actin-1 OS=Plasmodium berghei (strain Anka) GN=PB000323.01.0 PE=1 SV=1 7 386 7.0E-110
sp|P02581|ACT1_SOYBN Actin-1 OS=Glycine max GN=SAC1 PE=3 SV=2 6 386 7.0E-110
sp|P53477|ACT_TRYCR Actin OS=Trypanosoma cruzi PE=3 SV=1 7 386 8.0E-110
sp|Q7RPB4|ACT2_PLAYO Actin-2 OS=Plasmodium yoelii yoelii GN=PY01545 PE=3 SV=1 7 386 2.0E-109
sp|P14883|ACT2_PLAFO Actin-2 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 7 386 2.0E-109
sp|P10993|ACT2_TETPY Actin, cytoplasmic OS=Tetrahymena pyriformis PE=3 SV=2 3 386 4.0E-109
sp|P23343|ACT1_DAUCA Actin-1 OS=Daucus carota PE=2 SV=1 6 386 1.0E-108
sp|P12431|ACTM_STRPU Actin, muscle OS=Strongylocentrotus purpuratus PE=3 SV=1 7 376 2.0E-108
sp|P10992|ACT1_TETTH Actin, macronuclear OS=Tetrahymena thermophila PE=1 SV=3 5 386 2.0E-108
sp|P18602|ACT3_ARTSX Actin, clone 302 (Fragment) OS=Artemia sp. PE=2 SV=1 52 386 2.0E-108
sp|A5DQP9|ACT_PICGU Actin OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ACT1 PE=3 SV=1 17 385 4.0E-108
sp|Q8SWN8|ACT_ENCCU Actin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0460 PE=1 SV=2 7 386 6.0E-108
sp|P02580|ACT3_SOYBN Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2 6 386 7.0E-108
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 7 386 1.0E-107
sp|Q55EU6|ACT23_DICDI Putative actin-23 OS=Dictyostelium discoideum GN=act23 PE=1 SV=1 17 386 2.0E-107
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 7 386 3.0E-107
sp|Q99023|ACT_HYPJE Actin OS=Hypocrea jecorina GN=act PE=3 SV=1 7 385 1.0E-106
sp|Q4YU79|ACT2_PLABA Actin-2 OS=Plasmodium berghei (strain Anka) GN=PB001050.02.0 PE=1 SV=1 7 386 1.0E-106
sp|P24263|ACTD_PHYPO Actin, spherule isoform OS=Physarum polycephalum GN=ARDD PE=2 SV=2 7 386 2.0E-106
sp|P30161|ACT_COSCS Actin (Fragment) OS=Costaria costata PE=3 SV=2 52 386 3.0E-106
sp|P45520|ACT_LEIMA Actin OS=Leishmania major PE=3 SV=1 7 386 3.0E-106
sp|P53468|ACT1_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 1 386 3.0E-106
sp|P45521|ACT_PROCL Actin (Fragment) OS=Procambarus clarkii PE=1 SV=1 57 386 5.0E-106
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 7 386 1.0E-105
sp|Q96483|ACT2_SOLLC Actin-51 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 18 362 2.0E-105
sp|P53491|ACT_ACEPE Actin (Fragment) OS=Acetabularia peniculus PE=3 SV=1 19 386 3.0E-105
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 7 386 3.0E-105
sp|Q96484|ACT3_SOLLC Actin-52 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 18 362 4.0E-105
sp|O00937|ACT_STECV Actin OS=Sterkiella cavicola PE=3 SV=2 1 386 2.0E-104
sp|P81228|ACT5_SOLTU Actin-66 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 2.0E-104
sp|P55805|ACT2_STENO Actin, cytoplasmic OS=Sterkiella nova GN=MIC-ACT-1 PE=3 SV=1 1 386 2.0E-104
sp|Q96482|ACT1_SOLLC Actin-41 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 18 362 2.0E-104
sp|P12715|ACT1_STENO Actin, cytoplasmic OS=Sterkiella nova PE=3 SV=1 1 386 4.0E-104
sp|P81229|ACT8_SOLTU Actin-79 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 5.0E-104
sp|P93372|ACT4_TOBAC Actin-66 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 6.0E-104
sp|P93371|ACT5_TOBAC Actin-93 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 18 362 8.0E-104
sp|P51775|ACT_GIAIN Actin OS=Giardia intestinalis PE=3 SV=1 5 386 1.0E-103
sp|P93586|ACT2_SOLTU Actin-46 (Fragment) OS=Solanum tuberosum PE=3 SV=1 18 362 1.0E-103
sp|P93584|ACT9_SOLTU Actin-82 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 2.0E-103
sp|Q54HF0|ACT25_DICDI Putative actin-25 OS=Dictyostelium discoideum GN=act25 PE=3 SV=1 7 386 3.0E-103
sp|P93376|ACT6_TOBAC Actin-103 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 3.0E-103
sp|P53483|ACTX_TAKRU Actin, alpha anomalous OS=Takifugu rubripes PE=2 SV=1 7 385 3.0E-103
sp|P20360|ACT_EUPCR Actin, cytoplasmic OS=Euplotes crassus PE=3 SV=1 7 386 4.0E-103
sp|P93375|ACT7_TOBAC Actin-104 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 4.0E-103
sp|Q03342|ACT3_ECHGR Actin-3 (Fragment) OS=Echinococcus granulosus GN=ACTIII PE=2 SV=1 69 386 7.0E-103
sp|P30169|ACT7_SOLTU Actin-75 OS=Solanum tuberosum GN=AC75 PE=3 SV=1 6 386 1.0E-102
sp|P93373|ACT3_TOBAC Actin-54 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 18 362 2.0E-102
sp|P93374|ACT2_TOBAC Actin-53 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 19 362 4.0E-102
sp|Q554S6|ACT17_DICDI Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1 2 386 5.0E-102
sp|P27132|ACT2_NAEFO Actin-2 (Fragment) OS=Naegleria fowleri PE=2 SV=1 9 386 6.0E-102
sp|P93587|ACT1_SOLTU Actin-42 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 1.0E-101
sp|P93585|ACT4_SOLTU Actin-65 (Fragment) OS=Solanum tuberosum PE=3 SV=1 19 362 4.0E-101
sp|Q55CU2|ACT26_DICDI Putative actin-26 OS=Dictyostelium discoideum GN=act26 PE=3 SV=1 3 386 8.0E-101
sp|P53469|ACT2_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 1 386 2.0E-99
sp|Q54HF1|ACT24_DICDI Putative actin-24 OS=Dictyostelium discoideum GN=act24 PE=3 SV=1 7 386 4.0E-99
sp|Q96481|ACT4_SOLLC Actin-105 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 19 362 2.0E-98
sp|Q8R5C5|ACTY_MOUSE Beta-centractin OS=Mus musculus GN=Actr1b PE=1 SV=1 6 386 4.0E-98
sp|P85515|ACTZ_RAT Alpha-centractin OS=Rattus norvegicus GN=Actr1a PE=1 SV=1 6 386 4.0E-98
sp|P61164|ACTZ_MOUSE Alpha-centractin OS=Mus musculus GN=Actr1a PE=1 SV=1 6 386 4.0E-98
sp|Q4R6J9|ACTZ_MACFA Alpha-centractin OS=Macaca fascicularis GN=ACTR1A PE=2 SV=1 6 386 4.0E-98
sp|P61163|ACTZ_HUMAN Alpha-centractin OS=Homo sapiens GN=ACTR1A PE=1 SV=1 6 386 4.0E-98
sp|P61162|ACTZ_CANLF Alpha-centractin OS=Canis lupus familiaris GN=ACTR1A PE=2 SV=1 6 386 4.0E-98
sp|A4IFE3|ACTY_BOVIN Beta-centractin OS=Bos taurus GN=ACTR1B PE=2 SV=1 6 386 5.0E-98
sp|P45891|ACTY_DROME Actin-like protein 53D OS=Drosophila melanogaster GN=Arp53D PE=2 SV=2 7 386 6.0E-98
sp|P42025|ACTY_HUMAN Beta-centractin OS=Homo sapiens GN=ACTR1B PE=1 SV=1 6 386 1.0E-97
sp|P23344|ACT2_DAUCA Actin-2 OS=Daucus carota PE=2 SV=1 6 386 3.0E-96
sp|Q54I79|ACTY_DICDI Centractin OS=Dictyostelium discoideum GN=arpA PE=1 SV=1 6 386 1.0E-94
sp|P45889|ACTZ_DROME Actin-related protein 1 OS=Drosophila melanogaster GN=Arp1 PE=2 SV=2 6 386 2.0E-94
sp|P93738|ACT9_ARATH Putative actin-9 OS=Arabidopsis thaliana GN=ACT9 PE=5 SV=1 6 386 2.0E-93
sp|Q8BXF8|ACTT3_MOUSE Actin-related protein T3 OS=Mus musculus GN=Actrt3 PE=1 SV=1 2 386 4.0E-92
sp|P38673|ACTZ_NEUCR Actin-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-4 PE=3 SV=1 6 387 5.0E-92
sp|P42023|ACTZ_PNECA Actin-2 OS=Pneumocystis carinii PE=2 SV=1 6 378 6.0E-92
sp|P02583|ACT2_OXYFA Actin, cytoplasmic OS=Oxytricha fallax PE=3 SV=1 1 386 1.0E-90
sp|Q92192|ACT_CALFI Actin (Fragment) OS=Calanus finmarchicus PE=2 SV=1 81 370 3.0E-90
sp|Q9BYD9|ACTT3_HUMAN Actin-related protein T3 OS=Homo sapiens GN=ACTRT3 PE=2 SV=1 6 386 4.0E-87
sp|P53503|ACT1_OXYFA Actin, macronuclear OS=Oxytricha fallax PE=3 SV=1 1 386 7.0E-87
sp|Q2TA43|ACTT2_BOVIN Actin-related protein T2 OS=Bos taurus GN=ACTRT2 PE=2 SV=1 3 386 1.0E-86
sp|Q8TDY3|ACTT2_HUMAN Actin-related protein T2 OS=Homo sapiens GN=ACTRT2 PE=2 SV=2 3 386 2.0E-86
sp|Q92193|ACT_CRAVI Actin (Fragment) OS=Crassostrea virginica PE=2 SV=1 87 362 3.0E-86
sp|Q4R317|ACTT2_MACFA Actin-related protein T2 OS=Macaca fascicularis GN=ACTRT2 PE=2 SV=1 3 386 6.0E-86
sp|Q9D9L5|ACTT2_MOUSE Actin-related protein T2 OS=Mus musculus GN=Actrt2 PE=2 SV=1 3 386 6.0E-84
sp|Q8TDG2|ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens GN=ACTRT1 PE=2 SV=2 1 386 2.0E-82
sp|Q4R821|ACTT1_MACFA Actin-related protein T1 OS=Macaca fascicularis GN=ACTRT1 PE=2 SV=1 5 386 2.0E-80
sp|Q9D9J3|ACTT1_MOUSE Actin-related protein T1 OS=Mus musculus GN=Actrt1 PE=2 SV=1 5 386 3.0E-78
sp|O94630|ARP1_SCHPO Centractin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp1 PE=3 SV=1 6 362 5.0E-78
sp|Q54HE9|ACT27_DICDI Putative actin-27 OS=Dictyostelium discoideum GN=act27 PE=3 SV=2 3 384 6.0E-78
sp|Q54HE7|ACT28_DICDI Putative actin-28 OS=Dictyostelium discoideum GN=act28 PE=3 SV=1 3 380 1.0E-76
sp|Q5XIK1|ACTT1_RAT Actin-related protein T1 OS=Rattus norvegicus GN=Actrt1 PE=2 SV=1 5 386 2.0E-76
sp|P38696|ARP1_YEAST Centractin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP1 PE=1 SV=1 6 383 2.0E-75
sp|Q641W9|ACL7A_RAT Actin-like protein 7A OS=Rattus norvegicus GN=Actl7a PE=1 SV=1 7 384 2.0E-68
sp|Q4R6Q3|ACL7A_MACFA Actin-like protein 7A OS=Macaca fascicularis GN=ACTL7A PE=2 SV=1 7 384 3.0E-68
sp|Q9QY84|ACL7A_MOUSE Actin-like protein 7A OS=Mus musculus GN=Actl7a PE=1 SV=1 7 384 6.0E-68
sp|Q95JK8|ACL7B_MACFA Actin-like protein 7B OS=Macaca fascicularis GN=ACTL7B PE=2 SV=1 7 380 7.0E-68
sp|Q54L54|ACT29_DICDI Putative actin-29 OS=Dictyostelium discoideum GN=act29 PE=3 SV=1 7 386 1.0E-67
sp|Q9Y614|ACL7B_HUMAN Actin-like protein 7B OS=Homo sapiens GN=ACTL7B PE=2 SV=1 7 380 3.0E-67
sp|Q32KZ2|ACL7A_BOVIN Actin-like protein 7A OS=Bos taurus GN=ACTL7A PE=2 SV=1 7 384 3.0E-67
sp|Q9Y615|ACL7A_HUMAN Actin-like protein 7A OS=Homo sapiens GN=ACTL7A PE=1 SV=1 7 384 3.0E-67
sp|Q4QR76|ACL7B_RAT Actin-like protein 7B OS=Rattus norvegicus GN=Actl7b PE=1 SV=1 7 380 2.0E-66
sp|Q32L91|ACL7B_BOVIN Actin-like protein 7B OS=Bos taurus GN=ACTL7B PE=2 SV=1 7 380 3.0E-66
sp|Q9QY83|ACL7B_MOUSE Actin-like protein 7B OS=Mus musculus GN=Actl7b PE=1 SV=2 7 380 5.0E-65
sp|P78712|ARP3_NEUCR Actin-related protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-3 PE=2 SV=2 5 387 7.0E-65
sp|Q9N4I0|ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans GN=arx-1 PE=3 SV=1 5 389 1.0E-64
sp|Q2T9W4|ACTL9_BOVIN Actin-like protein 9 OS=Bos taurus GN=ACTL9 PE=2 SV=1 7 384 1.0E-63
sp|Q8TC94|ACTL9_HUMAN Actin-like protein 9 OS=Homo sapiens GN=ACTL9 PE=1 SV=3 7 386 3.0E-63
sp|Q61WW9|ARP3_CAEBR Actin-related protein 3 OS=Caenorhabditis briggsae GN=arx-1 PE=3 SV=1 5 389 6.0E-63
sp|Q6AY16|ACTL9_RAT Actin-like protein 9 OS=Rattus norvegicus GN=Actl9 PE=2 SV=1 7 384 2.0E-62
sp|Q8CG27|ACTL9_MOUSE Actin-like protein 9 OS=Mus musculus GN=Actl9 PE=1 SV=1 7 384 1.0E-61
sp|P32390|ARP3_SCHPO Actin-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act2 PE=1 SV=1 6 387 2.0E-61
sp|P47117|ARP3_YEAST Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP3 PE=1 SV=1 3 387 3.0E-61
sp|P30170|ACT10_SOLTU Actin-85C (Fragment) OS=Solanum tuberosum GN=AC85C PE=3 SV=1 19 215 2.0E-60
sp|Q9SAF1|ARP3_ARATH Actin-related protein 3 OS=Arabidopsis thaliana GN=ARP3 PE=1 SV=1 5 384 2.0E-60
sp|Q6K908|ARP3_ORYSJ Actin-related protein 3 OS=Oryza sativa subsp. japonica GN=ARP3 PE=2 SV=1 5 384 2.0E-60
sp|A2X6S3|ARP3_ORYSI Actin-related protein 3 OS=Oryza sativa subsp. indica GN=ARP3 PE=3 SV=2 5 384 2.0E-60
sp|Q641P0|ARP3B_MOUSE Actin-related protein 3B OS=Mus musculus GN=Actr3b PE=1 SV=1 2 384 7.0E-59
sp|Q9P1U1|ARP3B_HUMAN Actin-related protein 3B OS=Homo sapiens GN=ACTR3B PE=2 SV=1 2 384 3.0E-58
sp|P42528|ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum GN=arpC PE=1 SV=1 5 384 4.0E-58
sp|P53490|ARP3_ACACA Actin-related protein 3 OS=Acanthamoeba castellanii GN=ARP3 PE=2 SV=1 5 384 1.0E-56
sp|Q90WD0|ARP3_CHICK Actin-related protein 3 OS=Gallus gallus GN=ACTR3 PE=2 SV=1 2 384 1.0E-56
sp|P32392|ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster GN=Arp3 PE=2 SV=3 2 384 6.0E-56
sp|D0LWX4|BARP_HALO1 Bacterial actin-related protein OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=barP PE=2 SV=1 6 384 3.0E-55
sp|Q4V7C7|ARP3_RAT Actin-related protein 3 OS=Rattus norvegicus GN=Actr3 PE=1 SV=1 2 384 9.0E-55
sp|Q99JY9|ARP3_MOUSE Actin-related protein 3 OS=Mus musculus GN=Actr3 PE=1 SV=3 2 384 9.0E-55
sp|Q5R8R1|ARP3_PONAB Actin-related protein 3 OS=Pongo abelii GN=ACTR3 PE=2 SV=3 2 384 1.0E-54
sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens GN=ACTR3 PE=1 SV=3 2 384 1.0E-54
sp|P61157|ARP3_BOVIN Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=1 SV=3 2 384 1.0E-54
sp|O73723|ARP3_TAKRU Actin-related protein 3 OS=Takifugu rubripes GN=actr3 PE=3 SV=1 2 384 6.0E-54
sp|Q84M92|ARP4_ARATH Actin-related protein 4 OS=Arabidopsis thaliana GN=ARP4 PE=1 SV=1 7 389 5.0E-49
sp|Q11212|ACT_SPOLI Actin (Fragment) OS=Spodoptera littoralis PE=2 SV=1 9 175 2.0E-48
sp|A2AKE7|ACL10_MOUSE Actin-like protein 10 OS=Mus musculus GN=Actl10 PE=3 SV=1 70 381 8.0E-47
sp|Q9H568|ACTL8_HUMAN Actin-like protein 8 OS=Homo sapiens GN=ACTL8 PE=1 SV=1 7 379 7.0E-46
sp|Q8L4Y5|ARP7_ARATH Actin-related protein 7 OS=Arabidopsis thaliana GN=ARP7 PE=1 SV=1 7 386 1.0E-44
sp|Q25381|ACTM_LYTPI Actin, muscle (Fragment) OS=Lytechinus pictus PE=3 SV=1 206 386 2.0E-44
sp|Q25379|ACT3_LYTPI Actin, cytoskeletal 3 (Fragment) OS=Lytechinus pictus PE=3 SV=1 206 386 4.0E-44
sp|A3ANB5|ARP7_ORYSJ Actin-related protein 7 OS=Oryza sativa subsp. japonica GN=ARP7 PE=2 SV=2 7 386 6.0E-43
sp|A2XMK6|ARP7_ORYSI Actin-related protein 7 OS=Oryza sativa subsp. indica GN=ARP7 PE=2 SV=2 7 386 6.0E-43
sp|Q6C061|ARP4_YARLI Actin-related protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP4 PE=3 SV=1 7 380 2.0E-42
sp|Q6ZJW9|ARP4_ORYSJ Actin-related protein 4 OS=Oryza sativa subsp. japonica GN=ARP4 PE=2 SV=1 7 389 2.0E-40
sp|A2YR10|ARP4_ORYSI Actin-related protein 4 OS=Oryza sativa subsp. indica GN=ARP4 PE=3 SV=2 7 389 2.0E-40
sp|Q25380|ACT4_LYTPI Actin, cytoskeletal 4 (Fragment) OS=Lytechinus pictus PE=3 SV=1 216 381 3.0E-39
sp|P24902|ACT_PINCO Actin (Fragment) OS=Pinus contorta PE=3 SV=1 217 386 4.0E-38
sp|Q8LGE3|ARP6_ARATH Actin-related protein 6 OS=Arabidopsis thaliana GN=ARP6 PE=1 SV=1 7 380 5.0E-38
sp|Q4R333|ACL6A_MACFA Actin-like protein 6A OS=Macaca fascicularis GN=ACTL6A PE=2 SV=1 7 389 4.0E-37
sp|Q09849|ARP42_SCHPO SWI/SNF and RSC complexes subunit arp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp42 PE=1 SV=2 5 380 6.0E-37
sp|O96019|ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens GN=ACTL6A PE=1 SV=1 7 389 8.0E-37
sp|Q9Z2N8|ACL6A_MOUSE Actin-like protein 6A OS=Mus musculus GN=Actl6a PE=1 SV=2 7 389 1.0E-36
sp|Q9GZN1|ARP6_HUMAN Actin-related protein 6 OS=Homo sapiens GN=ACTR6 PE=1 SV=1 7 386 5.0E-36
sp|Q6C982|ARP6_YARLI Actin-like protein ARP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP6 PE=3 SV=1 56 386 6.0E-36
sp|Q9D864|ARP6_MOUSE Actin-related protein 6 OS=Mus musculus GN=Actr6 PE=1 SV=2 7 386 1.0E-35
sp|O94805|ACL6B_HUMAN Actin-like protein 6B OS=Homo sapiens GN=ACTL6B PE=1 SV=1 7 389 3.0E-35
sp|Q9DEE9|ARP6_CHICK Actin-related protein 6 OS=Gallus gallus GN=ACTR6 PE=1 SV=1 7 386 3.0E-35
sp|P86173|ACL6B_RAT Actin-like protein 6B OS=Rattus norvegicus GN=Actl6b PE=1 SV=2 7 389 3.0E-35
sp|Q99MR0|ACL6B_MOUSE Actin-like protein 6B OS=Mus musculus GN=Actl6b PE=1 SV=1 7 389 3.0E-35
sp|A4FUX8|ACL6B_BOVIN Actin-like protein 6B OS=Bos taurus GN=ACTL6B PE=2 SV=1 7 389 3.0E-35
sp|Q5NBI2|ARP6_ORYSJ Actin-related protein 6 OS=Oryza sativa subsp. japonica GN=ARP6 PE=2 SV=1 7 380 9.0E-35
sp|A2WNB0|ARP6_ORYSI Actin-related protein 6 OS=Oryza sativa subsp. indica GN=ARP6 PE=3 SV=1 7 380 9.0E-35
sp|P10982|ACT1_ABSGL Actin-1 (Fragment) OS=Absidia glauca GN=ACT1 PE=3 SV=1 7 140 5.0E-32
sp|Q9P7X7|ARP4_SCHPO Actin-related protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp5 PE=3 SV=1 7 380 2.0E-31
sp|Q5JWF8|ACL10_HUMAN Actin-like protein 10 OS=Homo sapiens GN=ACTL10 PE=2 SV=1 136 384 4.0E-30
sp|P10994|ACTS_PLEWA Actin, alpha skeletal muscle (Fragment) OS=Pleurodeles waltl PE=2 SV=1 253 386 2.0E-29
sp|Q5AW89|ARP4_EMENI Actin-related protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp4 PE=3 SV=1 7 386 2.0E-29
sp|Q09443|ARP6_CAEEL Actin-like protein C08B11.6 OS=Caenorhabditis elegans GN=arp-6 PE=2 SV=3 7 380 4.0E-28
sp|P00544|FGR_FSVGR Tyrosine-protein kinase transforming protein Fgr OS=Feline sarcoma virus (strain Gardner-Rasheed) GN=V-FGR PE=3 SV=1 7 137 6.0E-28
sp|Q7S6X6|ARP6_NEUCR Actin-related protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-6 PE=3 SV=1 2 380 2.0E-27
sp|Q7XR80|ARP8_ORYSJ Actin-related protein 8 OS=Oryza sativa subsp. japonica GN=ARP8 PE=2 SV=1 91 382 2.0E-27
sp|A8WAT2|ARP8_ORYSI Actin-related protein 8 OS=Oryza sativa subsp. indica GN=ARP8 PE=3 SV=1 91 382 2.0E-27
sp|Q39596|ACT_OXYRB Actin (Fragment) OS=Oxybasis rubra PE=3 SV=1 87 169 5.0E-27
sp|P45890|ARP6_DROME Actin-related protein 6 OS=Drosophila melanogaster GN=Arp6 PE=1 SV=1 7 380 1.0E-26
sp|O94241|ARP6_SCHPO Actin-like protein arp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp6 PE=3 SV=1 1 322 1.0E-25
sp|Q5AXH1|ARP6_EMENI Actin-like protein arp6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arp6 PE=3 SV=1 7 380 4.0E-25
sp|P86700|ACT_CHIOP Actin, muscle (Fragments) OS=Chionoecetes opilio PE=1 SV=1 18 334 1.0E-24
sp|Q4W9M3|ARP6_ASPFU Actin-like protein arp6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp6 PE=3 SV=1 7 380 3.0E-24
sp|Q4WHA3|ARP4_ASPFU Actin-related protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arp4 PE=3 SV=1 7 386 6.0E-23
sp|Q9C0K3|ARP3C_HUMAN Actin-related protein 3C OS=Homo sapiens GN=ACTR3C PE=2 SV=1 125 297 6.0E-22
sp|P0CM04|ARP6_CRYNJ Actin-like protein ARP6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARP6 PE=3 SV=1 1 388 8.0E-22
sp|P0CM05|ARP6_CRYNB Actin-like protein ARP6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARP6 PE=3 SV=1 1 388 8.0E-22
sp|Q4P2E8|ARP4_USTMA Actin-related protein 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ARP4 PE=3 SV=1 77 385 2.0E-21
sp|Q9FKT0|ARP8_ARATH Actin-related protein 8 OS=Arabidopsis thaliana GN=ARP8 PE=2 SV=1 4 320 6.0E-20
sp|Q9QZB7|ARP10_MOUSE Actin-related protein 10 OS=Mus musculus GN=Actr10 PE=1 SV=2 2 380 7.0E-20
sp|Q9NZ32|ARP10_HUMAN Actin-related protein 10 OS=Homo sapiens GN=ACTR10 PE=1 SV=1 2 380 3.0E-19
sp|P80428|ARP4_YEAST Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 7 231 5.0E-19
sp|Q4IPI4|ARP4_GIBZE Actin-related protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ARP4 PE=3 SV=1 7 386 6.0E-19
sp|Q3ZBD2|ARP10_BOVIN Actin-related protein 10 OS=Bos taurus GN=ACTR10 PE=2 SV=1 2 380 5.0E-18
sp|Q940Z2|ARP5_ARATH Actin-related protein 5 OS=Arabidopsis thaliana GN=ARP5 PE=1 SV=2 6 243 2.0E-17
sp|Q9Y7X8|ARP5_SCHPO Actin-like protein arp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp5 PE=1 SV=1 1 195 4.0E-17
sp|Q54KZ7|ARP6_DICDI Actin-related protein 6 OS=Dictyostelium discoideum GN=arpF PE=3 SV=1 7 233 2.0E-16
sp|Q7SHR0|ARP4_NEUCR Actin-related protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-4 PE=3 SV=2 7 386 8.0E-16
sp|Q17GZ9|ARP5_AEDAE Actin-related protein 5 OS=Aedes aegypti GN=Arp5 PE=3 SV=1 4 224 1.0E-15
sp|Q6CSB9|ARP4_KLULA Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 7 198 8.0E-15
sp|Q754G5|ARP4_ASHGO Actin-related protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP4 PE=3 SV=1 7 268 8.0E-15
sp|Q6BML9|ARP6_DEBHA Actin-like protein ARP6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARP6 PE=3 SV=2 7 388 2.0E-14
sp|Q5AC48|ARP4_CANAL Actin-related protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP4 PE=3 SV=2 7 196 7.0E-14
sp|P59679|ARP8_DANRE Actin-related protein 8 OS=Danio rerio GN=actr8 PE=2 SV=1 83 294 7.0E-14
sp|Q12509|ARP6_YEAST Actin-like protein ARP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP6 PE=1 SV=1 5 321 1.0E-13
sp|Q6FJV8|ARP4_CANGA Actin-related protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP4 PE=3 SV=1 7 198 3.0E-13
sp|B5X2S3|ARP8_SALSA Actin-related protein 8 OS=Salmo salar GN=actr8 PE=2 SV=1 83 266 4.0E-13
sp|Q74ZV8|ARP6_ASHGO Actin-like protein ARP6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP6 PE=3 SV=1 65 321 4.0E-13
sp|Q54E71|ARP5_DICDI Actin-related protein 5 OS=Dictyostelium discoideum GN=arpE PE=3 SV=1 2 222 6.0E-13
sp|Q9H9F9|ARP5_HUMAN Actin-related protein 5 OS=Homo sapiens GN=ACTR5 PE=1 SV=2 226 386 6.0E-13
sp|Q5AP59|ARP6_CANAL Actin-like protein ARP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP6 PE=3 SV=1 67 388 1.0E-12
sp|Q9C9B2|ARP4A_ARATH Actin-related protein 4A OS=Arabidopsis thaliana GN=ARP4A PE=2 SV=1 7 120 2.0E-12
sp|Q6CJF4|ARP6_KLULA Actin-like protein ARP6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP6 PE=3 SV=1 5 321 2.0E-12
sp|Q6FKE7|ARP6_CANGA Actin-like protein ARP6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP6 PE=3 SV=1 72 327 1.0E-11
sp|Q9H9F9|ARP5_HUMAN Actin-related protein 5 OS=Homo sapiens GN=ACTR5 PE=1 SV=2 4 195 1.0E-09
sp|P80428|ARP4_YEAST Actin-related protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP4 PE=1 SV=1 265 380 4.0E-09
sp|Q54KZ7|ARP6_DICDI Actin-related protein 6 OS=Dictyostelium discoideum GN=arpF PE=3 SV=1 248 380 4.0E-09
sp|Q6FJV8|ARP4_CANGA Actin-related protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARP4 PE=3 SV=1 272 384 3.0E-08
sp|Q754G5|ARP4_ASHGO Actin-related protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARP4 PE=3 SV=1 271 386 1.0E-07
sp|Q5AC48|ARP4_CANAL Actin-related protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP4 PE=3 SV=2 275 386 4.0E-07
sp|Q6CSB9|ARP4_KLULA Actin-related protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARP4 PE=3 SV=1 270 386 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2164
MGNPPPIVLDGGTGFLKVGYAAQNFPEHQYPSIVGRPILRSEEKTDSDVIIKDIMCGDEAAAARTMLQISYPMEN
GIVKKWDDMQYLWDYTFFEKLKVDPSGQKILLTEPPMNPLKNREQMCEVMFDRYGFGGVYVAIQAVLALYAQGLS
SGVVVDSGDGVTHIVPVYESVVLNHLTKRLDVAGRDVTRNLIKLLLRRGYALNRTADFETVRQIKEKLCYVSYDL
ELDKRLSEDTTVLVENYTLPDGRVIRVGSERFEAPECLFQPHLVDSESPGLGEFLFNTIQSADVDIRASLFKAIV
LSGGSSMYPGLPSRLEKELKQLWLTRALQGNPERLGKFKVRIEDPPRRRHMVFLGGAVLANIMADNESMWVTKAE
WDEQGPRVLEKFGPR*
Coding >Hirsu2|2164
ATGGGAAACCCACCGCCTATCGTCCTCGACGGGGGAACTGGCTTCCTCAAGGTTGGCTATGCGGCGCAAAACTTC
CCCGAGCACCAGTACCCGTCGATCGTCGGGCGGCCGATCCTGCGATCCGAGGAGAAGACGGACAGCGATGTGATA
ATCAAGGACATCATGTGCGGCGACGAGGCGGCGGCCGCCCGAACCATGCTCCAGATCAGCTATCCCATGGAGAAC
GGCATCGTGAAGAAGTGGGACGACATGCAGTACCTCTGGGACTACACCTTCTTCGAGAAGCTCAAGGTCGATCCC
AGCGGGCAGAAGATCCTGCTGACGGAGCCACCCATGAACCCTCTCAAGAATCGGGAACAGATGTGCGAGGTCATG
TTTGACCGCTATGGCTTCGGCGGCGTCTACGTCGCCATCCAGGCGGTCCTGGCCTTGTACGCGCAGGGTCTCAGC
TCGGGTGTCGTGGTCGACTCGGGCGACGGCGTCACGCATATTGTCCCCGTATACGAGTCGGTGGTGCTGAACCAC
CTAACGAAGAGGCTGGACGTTGCCGGGCGCGACGTGACGCGCAACTTGATCAAGCTTCTCCTGCGCCGCGGCTAC
GCGCTGAACCGGACGGCCGACTTCGAGACGGTGCGGCAGATCAAGGAGAAGCTGTGCTACGTGTCGTACGACCTG
GAGCTGGACAAGCGGCTGAGCGAGGACACAACGGTGCTGGTGGAGAACTACACGCTGCCCGACGGGCGGGTGATC
CGGGTGGGCAGCGAGCGGTTCGAGGCGCCCGAGTGCCTGTTCCAGCCGCATCTGGTAGACAGCGAGTCGCCGGGG
CTGGGCGAGTTCCTCTTCAACACGATCCAGTCGGCCGACGTGGACATCCGGGCGTCGCTGTTCAAGGCGATCGTG
CTGTCGGGGGGCAGCAGCATGTACCCGGGGCTGCCGTCGCGGCTGGAGAAAGAGCTGAAGCAGCTGTGGCTGACG
CGGGCGTTGCAGGGCAACCCGGAGCGGCTGGGCAAGTTCAAGGTGCGGATAGAGGATCCGCCGCGGCGGAGACAT
ATGGTCTTCCTCGGGGGCGCGGTGCTGGCCAACATCATGGCCGACAACGAGAGCATGTGGGTGACTAAGGCGGAG
TGGGACGAGCAGGGCCCGCGCGTGCTGGAAAAGTTTGGACCGCGATAG
Transcript >Hirsu2|2164
ATGGGAAACCCACCGCCTATCGTCCTCGACGGGGGAACTGGCTTCCTCAAGGTTGGCTATGCGGCGCAAAACTTC
CCCGAGCACCAGTACCCGTCGATCGTCGGGCGGCCGATCCTGCGATCCGAGGAGAAGACGGACAGCGATGTGATA
ATCAAGGACATCATGTGCGGCGACGAGGCGGCGGCCGCCCGAACCATGCTCCAGATCAGCTATCCCATGGAGAAC
GGCATCGTGAAGAAGTGGGACGACATGCAGTACCTCTGGGACTACACCTTCTTCGAGAAGCTCAAGGTCGATCCC
AGCGGGCAGAAGATCCTGCTGACGGAGCCACCCATGAACCCTCTCAAGAATCGGGAACAGATGTGCGAGGTCATG
TTTGACCGCTATGGCTTCGGCGGCGTCTACGTCGCCATCCAGGCGGTCCTGGCCTTGTACGCGCAGGGTCTCAGC
TCGGGTGTCGTGGTCGACTCGGGCGACGGCGTCACGCATATTGTCCCCGTATACGAGTCGGTGGTGCTGAACCAC
CTAACGAAGAGGCTGGACGTTGCCGGGCGCGACGTGACGCGCAACTTGATCAAGCTTCTCCTGCGCCGCGGCTAC
GCGCTGAACCGGACGGCCGACTTCGAGACGGTGCGGCAGATCAAGGAGAAGCTGTGCTACGTGTCGTACGACCTG
GAGCTGGACAAGCGGCTGAGCGAGGACACAACGGTGCTGGTGGAGAACTACACGCTGCCCGACGGGCGGGTGATC
CGGGTGGGCAGCGAGCGGTTCGAGGCGCCCGAGTGCCTGTTCCAGCCGCATCTGGTAGACAGCGAGTCGCCGGGG
CTGGGCGAGTTCCTCTTCAACACGATCCAGTCGGCCGACGTGGACATCCGGGCGTCGCTGTTCAAGGCGATCGTG
CTGTCGGGGGGCAGCAGCATGTACCCGGGGCTGCCGTCGCGGCTGGAGAAAGAGCTGAAGCAGCTGTGGCTGACG
CGGGCGTTGCAGGGCAACCCGGAGCGGCTGGGCAAGTTCAAGGTGCGGATAGAGGATCCGCCGCGGCGGAGACAT
ATGGTCTTCCTCGGGGGCGCGGTGCTGGCCAACATCATGGCCGACAACGAGAGCATGTGGGTGACTAAGGCGGAG
TGGGACGAGCAGGGCCCGCGCGTGCTGGAAAAGTTTGGACCGCGATAG
Gene >Hirsu2|2164
ATGGGAAACCCACCGCCTATCGGTATGCCACCTTACCTCTCCTCCCCCTTGCCGGGCCTCGTGAGCCTCGGCCCC
CGCCCGTACCGTCGGCCGGCCGCAGCGTCTCGACCCTCGATGATGGCATCGGCTGACACGTCCATCTCGCCGGCC
CGCAGTCCTCGACGGGGGAACTGGCTTCCTCAAGGTTGGCTATGCGGCGCAAAACTTCCCCGAGCACCAGTACCC
GTCGATCGTCGGGCGGCCGATCCTGCGATCCGAGGAGAAGACGGACAGCGATGTGATAATCAAGGACATCATGTG
CGGCGACGAGGCGGCGGCCGCCCGAACCATGCTCCAGATCAGCTATCCCATGGAGAACGGCATCGTGAAGAAGTG
GGACGACATGCAGTACCTCTGGGACTACACCTTCTTCGAGAAGCTCAAGGTCGATCCCAGCGGGCAGAAGATCCT
GCTGACGGAGCCACCCATGAACCCTCTCAAGAATCGGGAACAGATGTGCGAGGTCATGTTTGACCGCTATGGCTT
CGGCGGCGTCTACGTCGCCATCCAGGCGGTCCTGGCCTTGTACGCGCAGGGTGAGCCACCCGCCGACTGATCAGC
GGTCGAGCTTCCCCGCCGGGCCTTTCGCACGGGACTTGATACTTAACCGGTGTTGCCGCAGGTCTCAGCTCGGGT
GTCGTGGTCGACTCGGGCGACGGCGTCACGCATATTGTCCCCGTATACGAGTCGGTGGTGCTGAACCACCTAACG
AAGAGGCTGGACGTTGCCGGGCGCGACGTGACGCGCAACTTGATCAAGCTTCTCCTGCGCCGCGGCTACGCGCTG
AACCGGACGGCCGACTTCGAGACGGTGCGGCAGATCAAGGAGAAGCTGTGCTACGTGTCGTACGACCTGGAGCTG
GACAAGCGGCTGAGCGAGGACACAACGGTGCTGGTGGAGAACTACACGCTGCCCGACGGGCGGGTGATCCGGGTG
GGCAGCGAGCGGTTCGAGGCGCCCGAGTGCCTGTTCCAGCCGCATCTGGTAGACAGCGAGTCGCCGGGGCTGGGC
GAGTTCCTCTTCAACACGATCCAGTCGGCCGACGTGGACATCCGGGCGTCGCTGTTCAAGGCGATCGTGCTGTCG
GGGGGCAGCAGCATGTACCCGGGGCTGCCGTCGCGGCTGGAGAAAGAGCTGAAGCAGCTGTGGCTGACGCGGGCG
TTGCAGGGCAACCCGGAGCGGCTGGGCAAGTTCAAGGTGCGGATAGAGGATCCGCCGCGGCGGAGACATATGGTC
TTCCTCGGGGGCGCGGTGCTGGCCAACATCATGGCCGACAACGAGAGCATGTGGGTGACTAAGGCGGAGTGGGAC
GAGCAGGGCCCGCGCGTGCTGGAAAAGTTTGGACCGCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail