© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|2162 |
| Gene name | |
| Location | Contig_150:16172..16436 |
| Strand | + |
| Gene length (bp) | 264 |
| Transcript length (bp) | 264 |
| Coding sequence length (bp) | 264 |
| Protein length (aa) | 88 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00025 | Arf | ADP-ribosylation factor family | 2.5E-23 | 1 | 78 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P26990|ARF6_CHICK | ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 | 1 | 80 | 1.0E-36 |
| sp|P62332|ARF6_RAT | ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 | 1 | 80 | 4.0E-36 |
| sp|Q007T5|ARF6_PIG | ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 | 1 | 80 | 4.0E-36 |
| sp|P62331|ARF6_MOUSE | ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 | 1 | 80 | 4.0E-36 |
| sp|P62330|ARF6_HUMAN | ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 | 1 | 80 | 4.0E-36 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P26990|ARF6_CHICK | ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 | 1 | 80 | 1.0E-36 |
| sp|P62332|ARF6_RAT | ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 | 1 | 80 | 4.0E-36 |
| sp|Q007T5|ARF6_PIG | ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 | 1 | 80 | 4.0E-36 |
| sp|P62331|ARF6_MOUSE | ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 | 1 | 80 | 4.0E-36 |
| sp|P62330|ARF6_HUMAN | ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 | 1 | 80 | 4.0E-36 |
| sp|P51645|ARF6_XENLA | ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2 | 1 | 80 | 2.0E-35 |
| sp|P40946|ARF3_DROME | ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3 | 1 | 79 | 4.0E-34 |
| sp|Q9Y7Z2|ARF6_SCHPO | ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf6 PE=3 SV=1 | 1 | 79 | 4.0E-32 |
| sp|O48920|ARF_VIGUN | ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3 | 3 | 80 | 1.0E-26 |
| sp|O48649|ARF1_SALBA | ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3 | 3 | 80 | 1.0E-26 |
| sp|P36397|ARF1_ARATH | ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2 | 3 | 80 | 1.0E-26 |
| sp|Q06396|ARF1_ORYSJ | ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 | 3 | 80 | 1.0E-26 |
| sp|P0DH91|ARF2B_ARATH | ADP-ribosylation factor 2-B OS=Arabidopsis thaliana GN=ARF2-B PE=2 SV=1 | 3 | 80 | 2.0E-26 |
| sp|Q9LQC8|ARF2A_ARATH | ADP-ribosylation factor 2-A OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=2 | 3 | 80 | 2.0E-26 |
| sp|P51823|ARF2_ORYSJ | ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 | 3 | 78 | 2.0E-26 |
| sp|P49076|ARF_MAIZE | ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 | 3 | 78 | 2.0E-26 |
| sp|P51821|ARF1_CHLRE | ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2 | 3 | 78 | 4.0E-26 |
| sp|P51822|ARF1_DAUCA | ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2 | 3 | 80 | 1.0E-25 |
| sp|O23778|ARF1_CATRO | ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3 | 3 | 78 | 1.0E-25 |
| sp|P34727|ARF_AJECA | ADP-ribosylation factor OS=Ajellomyces capsulatus GN=ARF PE=1 SV=3 | 3 | 79 | 2.0E-25 |
| sp|Q7RVM2|ARF_NEUCR | ADP-ribosylation factor OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08340 PE=3 SV=3 | 3 | 79 | 2.0E-25 |
| sp|Q94650|ARF1_PLAFA | ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=1 SV=3 | 1 | 79 | 4.0E-25 |
| sp|Q7KQL3|ARF1_PLAF7 | ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate 3D7) GN=ARF1 PE=1 SV=1 | 1 | 79 | 4.0E-25 |
| sp|P91924|ARF_DUGJA | ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3 | 1 | 79 | 5.0E-25 |
| sp|P40994|ARF3_YEAST | ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF3 PE=1 SV=2 | 1 | 81 | 2.0E-24 |
| sp|P36579|ARF1_SCHPO | ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf1 PE=2 SV=2 | 1 | 79 | 3.0E-24 |
| sp|Q25761|ARF1_PLAFO | ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate NF54) GN=ARF1 PE=2 SV=2 | 1 | 79 | 3.0E-24 |
| sp|P0CM16|ARF_CRYNJ | ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARF PE=1 SV=1 | 1 | 79 | 6.0E-24 |
| sp|P0CM17|ARF_CRYNB | ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARF PE=3 SV=1 | 1 | 79 | 6.0E-24 |
| sp|Q75A26|ARF_ASHGO | ADP-ribosylation factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARF1 PE=3 SV=3 | 3 | 79 | 6.0E-24 |
| sp|Q10943|ARF12_CAEEL | ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=2 SV=2 | 3 | 79 | 9.0E-24 |
| sp|Q61LA8|ARF12_CAEBR | ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3 | 3 | 79 | 9.0E-24 |
| sp|P19146|ARF2_YEAST | ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF2 PE=1 SV=3 | 1 | 79 | 1.0E-23 |
| sp|P51824|ARF1_SOLTU | ADP-ribosylation factor 1 OS=Solanum tuberosum PE=2 SV=2 | 1 | 79 | 2.0E-23 |
| sp|P61210|ARF1_LOCMI | ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2 | 1 | 79 | 4.0E-23 |
| sp|P61209|ARF1_DROME | ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2 | 1 | 79 | 4.0E-23 |
| sp|P51643|ARF1_XENLA | ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2 | 1 | 79 | 1.0E-22 |
| sp|P84079|ARF1_RAT | ADP-ribosylation factor 1 OS=Rattus norvegicus GN=Arf1 PE=1 SV=2 | 1 | 79 | 1.0E-22 |
| sp|P84078|ARF1_MOUSE | ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 PE=1 SV=2 | 1 | 79 | 1.0E-22 |
| sp|Q4R5P2|ARF1_MACFA | ADP-ribosylation factor 1 OS=Macaca fascicularis GN=ARF1 PE=2 SV=3 | 1 | 79 | 1.0E-22 |
| sp|P84077|ARF1_HUMAN | ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 PE=1 SV=2 | 1 | 79 | 1.0E-22 |
| sp|P84080|ARF1_BOVIN | ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE=1 SV=2 | 1 | 79 | 1.0E-22 |
| sp|P61207|ARF3_TAKRU | ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2 | 1 | 79 | 1.0E-22 |
| sp|P61206|ARF3_RAT | ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2 | 1 | 79 | 1.0E-22 |
| sp|Q5R5P7|ARF3_PONAB | ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3 | 1 | 79 | 1.0E-22 |
| sp|P61205|ARF3_MOUSE | ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 PE=2 SV=2 | 1 | 79 | 1.0E-22 |
| sp|P61204|ARF3_HUMAN | ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 PE=1 SV=2 | 1 | 79 | 1.0E-22 |
| sp|Q5E9I6|ARF3_BOVIN | ADP-ribosylation factor 3 OS=Bos taurus GN=ARF3 PE=2 SV=3 | 1 | 79 | 1.0E-22 |
| sp|P11076|ARF1_YEAST | ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF1 PE=1 SV=3 | 1 | 79 | 2.0E-22 |
| sp|P22274|ARF_CANAL | ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARF1 PE=3 SV=4 | 1 | 78 | 2.0E-22 |
| sp|P84082|ARF2_RAT | ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1 | 1 | 79 | 2.0E-22 |
| sp|Q8BSL7|ARF2_MOUSE | ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2 | 1 | 79 | 2.0E-22 |
| sp|P84081|ARF2_BOVIN | ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE=2 SV=1 | 1 | 79 | 2.0E-22 |
| sp|O00909|ARF1_DICDI | ADP-ribosylation factor 1 OS=Dictyostelium discoideum GN=arfA PE=1 SV=3 | 1 | 82 | 3.0E-21 |
| sp|P26991|ARF_GIAIN | ADP-ribosylation factor OS=Giardia intestinalis PE=3 SV=3 | 1 | 78 | 7.0E-21 |
| sp|Q96361|ARF1_BRARP | ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3 | 4 | 80 | 1.0E-20 |
| sp|P51644|ARF4_XENLA | ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf4 PE=1 SV=2 | 1 | 76 | 1.0E-20 |
| sp|P40940|ARF3_ARATH | ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2 | 4 | 80 | 2.0E-20 |
| sp|Q3SZF2|ARF4_BOVIN | ADP-ribosylation factor 4 OS=Bos taurus GN=ARF4 PE=2 SV=3 | 1 | 76 | 1.0E-19 |
| sp|P40945|ARF2_DROME | ADP-ribosylation factor 2 OS=Drosophila melanogaster GN=Arf102F PE=2 SV=2 | 1 | 75 | 3.0E-19 |
| sp|Q5RCF1|ARF4_PONAB | ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 PE=2 SV=3 | 1 | 76 | 4.0E-18 |
| sp|P18085|ARF4_HUMAN | ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 PE=1 SV=3 | 1 | 76 | 4.0E-18 |
| sp|P49702|ARF5_CHICK | ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5 PE=2 SV=2 | 3 | 76 | 4.0E-18 |
| sp|P84083|ARF5_RAT | ADP-ribosylation factor 5 OS=Rattus norvegicus GN=Arf5 PE=1 SV=2 | 3 | 76 | 5.0E-18 |
| sp|P84084|ARF5_MOUSE | ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 PE=1 SV=2 | 3 | 76 | 5.0E-18 |
| sp|P84085|ARF5_HUMAN | ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 PE=1 SV=2 | 3 | 76 | 5.0E-18 |
| sp|P61751|ARF4_RAT | ADP-ribosylation factor 4 OS=Rattus norvegicus GN=Arf4 PE=2 SV=2 | 1 | 76 | 1.0E-17 |
| sp|P61750|ARF4_MOUSE | ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 PE=1 SV=2 | 1 | 76 | 1.0E-17 |
| sp|Q9SHU5|ARF4_ARATH | Probable ADP-ribosylation factor At2g15310 OS=Arabidopsis thaliana GN=At2g15310 PE=2 SV=3 | 1 | 82 | 2.0E-17 |
| sp|P38116|ARL1_YEAST | ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 | 1 | 79 | 5.0E-17 |
| sp|Q9Y689|ARL5A_HUMAN | ADP-ribosylation factor-like protein 5A OS=Homo sapiens GN=ARL5A PE=1 SV=1 | 4 | 79 | 1.0E-16 |
| sp|Q80ZU0|ARL5A_MOUSE | ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=1 SV=1 | 4 | 79 | 1.0E-16 |
| sp|P51646|ARL5A_RAT | ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1 | 4 | 79 | 1.0E-16 |
| sp|Q54V47|ARFJ_DICDI | ADP-ribosylation factor J OS=Dictyostelium discoideum GN=arrJ PE=3 SV=1 | 1 | 78 | 2.0E-16 |
| sp|Q94231|ARF11_CAEEL | ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3 | 3 | 80 | 3.0E-16 |
| sp|Q9D4P0|ARL5B_MOUSE | ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3 | 4 | 78 | 5.0E-16 |
| sp|Q96KC2|ARL5B_HUMAN | ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1 | 4 | 78 | 5.0E-16 |
| sp|Q2KJ96|ARL5A_BOVIN | ADP-ribosylation factor-like protein 5A OS=Bos taurus GN=ARL5A PE=2 SV=1 | 4 | 79 | 1.0E-15 |
| sp|Q54V41|ARFK_DICDI | ADP-ribosylation factor K OS=Dictyostelium discoideum GN=arrK PE=3 SV=1 | 1 | 78 | 7.0E-15 |
| sp|Q55AD9|ARL5_DICDI | ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1 | 5 | 78 | 1.0E-14 |
| sp|Q6P068|ARL5C_MOUSE | ADP-ribosylation factor-like protein 5C OS=Mus musculus GN=Arl5c PE=2 SV=1 | 5 | 80 | 1.0E-14 |
| sp|Q54JJ3|ARFH_DICDI | ADP-ribosylation factor H OS=Dictyostelium discoideum GN=arrH PE=3 SV=1 | 1 | 78 | 2.0E-14 |
| sp|Q8BGX0|TRI23_MOUSE | E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus GN=Trim23 PE=2 SV=1 | 1 | 80 | 2.0E-14 |
| sp|P36407|TRI23_RAT | E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus GN=Trim23 PE=2 SV=2 | 1 | 80 | 2.0E-14 |
| sp|P36406|TRI23_HUMAN | E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens GN=TRIM23 PE=1 SV=1 | 1 | 80 | 3.0E-14 |
| sp|P61212|ARL1_RAT | ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1 | 4 | 80 | 3.0E-14 |
| sp|P61211|ARL1_MOUSE | ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=1 SV=1 | 4 | 80 | 3.0E-14 |
| sp|Q54HK2|ARFF_DICDI | ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1 | 1 | 77 | 3.0E-14 |
| sp|Q54I24|ARFD_DICDI | ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2 | 1 | 78 | 8.0E-14 |
| sp|Q2YDM1|ARL1_BOVIN | ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1 | 4 | 80 | 9.0E-14 |
| sp|Q5M9P8|ARL6_DANRE | ADP-ribosylation factor-like protein 6 OS=Danio rerio GN=arl6 PE=2 SV=1 | 4 | 83 | 2.0E-13 |
| sp|Q9ZPX1|ARF5_ARATH | ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana GN=ARL2 PE=2 SV=1 | 1 | 80 | 3.0E-13 |
| sp|A6NH57|ARL5C_HUMAN | Putative ADP-ribosylation factor-like protein 5C OS=Homo sapiens GN=ARL5C PE=3 SV=4 | 4 | 80 | 5.0E-13 |
| sp|Q8QHI3|ARL3_XENLA | ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1 | 1 | 80 | 7.0E-13 |
| sp|P40616|ARL1_HUMAN | ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1 | 4 | 80 | 1.0E-12 |
| sp|Q1MTE5|ARL3_DANRE | ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1 | 1 | 80 | 1.0E-12 |
| sp|B5FYQ0|ARL3_TAEGU | ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1 | 1 | 78 | 3.0E-12 |
| sp|O45379|ARL3_CAEEL | ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans GN=arl-3 PE=1 SV=1 | 1 | 79 | 5.0E-12 |
| sp|Q3SXC5|ARL14_MOUSE | ADP-ribosylation factor-like protein 14 OS=Mus musculus GN=Arl14 PE=2 SV=1 | 1 | 80 | 7.0E-12 |
| sp|Q8N4G2|ARL14_HUMAN | ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=2 | 1 | 80 | 1.0E-11 |
| sp|P34212|ARL5_CAEEL | ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=3 SV=3 | 5 | 78 | 1.0E-11 |
| sp|Q0IIM2|ARL6_BOVIN | ADP-ribosylation factor-like protein 6 OS=Bos taurus GN=ARL6 PE=1 SV=1 | 4 | 83 | 2.0E-11 |
| sp|O88848|ARL6_MOUSE | ADP-ribosylation factor-like protein 6 OS=Mus musculus GN=Arl6 PE=1 SV=1 | 4 | 83 | 2.0E-11 |
| sp|Q5R4G5|ARL6_PONAB | ADP-ribosylation factor-like protein 6 OS=Pongo abelii GN=ARL6 PE=2 SV=1 | 4 | 83 | 4.0E-11 |
| sp|Q9H0F7|ARL6_HUMAN | ADP-ribosylation factor-like protein 6 OS=Homo sapiens GN=ARL6 PE=1 SV=1 | 4 | 83 | 4.0E-11 |
| sp|Q9WUL7|ARL3_MOUSE | ADP-ribosylation factor-like protein 3 OS=Mus musculus GN=Arl3 PE=1 SV=1 | 22 | 80 | 4.0E-11 |
| sp|P37996|ARL3_RAT | ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2 | 22 | 80 | 4.0E-11 |
| sp|Q52NJ4|ARL3_PIG | ADP-ribosylation factor-like protein 3 OS=Sus scrofa GN=ARL3 PE=2 SV=1 | 22 | 80 | 4.0E-11 |
| sp|P36405|ARL3_HUMAN | ADP-ribosylation factor-like protein 3 OS=Homo sapiens GN=ARL3 PE=1 SV=2 | 22 | 80 | 4.0E-11 |
| sp|Q5RCQ6|ARL3_PONAB | ADP-ribosylation factor-like protein 3 OS=Pongo abelii GN=ARL3 PE=2 SV=1 | 22 | 80 | 5.0E-11 |
| sp|P25160|ARL1_DROME | ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arl1 PE=2 SV=5 | 4 | 80 | 5.0E-11 |
| sp|Q2TA37|ARL2_BOVIN | ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 | 1 | 80 | 8.0E-11 |
| sp|A8ISN6|ARL3_CHLRE | ADP-ribosylation factor-like protein 3 OS=Chlamydomonas reinhardtii GN=ARL3 PE=1 SV=2 | 1 | 79 | 1.0E-10 |
| sp|Q2TBW6|ARL3_BOVIN | ADP-ribosylation factor-like protein 3 OS=Bos taurus GN=ARL3 PE=2 SV=1 | 22 | 80 | 2.0E-10 |
| sp|O08697|ARL2_RAT | ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=1 SV=1 | 1 | 80 | 2.0E-10 |
| sp|Q9D0J4|ARL2_MOUSE | ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 | 1 | 80 | 2.0E-10 |
| sp|P36404|ARL2_HUMAN | ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 | 1 | 80 | 3.0E-10 |
| sp|P61214|ARL4A_RAT | ADP-ribosylation factor-like protein 4A OS=Rattus norvegicus GN=Arl4a PE=2 SV=1 | 1 | 78 | 3.0E-10 |
| sp|P61213|ARL4A_MOUSE | ADP-ribosylation factor-like protein 4A OS=Mus musculus GN=Arl4a PE=2 SV=1 | 1 | 78 | 3.0E-10 |
| sp|Q3T0M9|ARL4A_BOVIN | ADP-ribosylation factor-like protein 4A OS=Bos taurus GN=ARL4A PE=2 SV=1 | 1 | 78 | 3.0E-10 |
| sp|P40617|ARL4A_HUMAN | ADP-ribosylation factor-like protein 4A OS=Homo sapiens GN=ARL4A PE=1 SV=2 | 1 | 78 | 3.0E-10 |
| sp|P61208|ARL4C_MOUSE | ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1 | 1 | 71 | 1.0E-09 |
| sp|P56559|ARL4C_HUMAN | ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=1 SV=1 | 1 | 71 | 1.0E-09 |
| sp|Q20758|ARL1_CAEEL | ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=3 SV=2 | 4 | 79 | 5.0E-09 |
| sp|Q627K4|ARL2_CAEBR | ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1 | 1 | 80 | 6.0E-09 |
| sp|Q54UF1|ARL2_DICDI | ADP-ribosylation factor-like protein 2 OS=Dictyostelium discoideum GN=arl2 PE=3 SV=1 | 22 | 78 | 1.0E-08 |
| sp|Q19705|ARL2_CAEEL | ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2 | 3 | 80 | 2.0E-08 |
| sp|Q09767|ARL_SCHPO | ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp41 PE=3 SV=1 | 1 | 79 | 4.0E-08 |
| sp|Q06849|ARL2_DROME | ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arl2 PE=2 SV=2 | 1 | 78 | 1.0E-07 |
| sp|Q969Q4|ARL11_HUMAN | ADP-ribosylation factor-like protein 11 OS=Homo sapiens GN=ARL11 PE=1 SV=1 | 2 | 71 | 2.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003924 | GTPase activity | Yes |
| GO:0005525 | GTP binding | Yes |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0005488 | binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0036094 | small molecule binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0043167 | ion binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| GO:0000166 | nucleotide binding | No |
| GO:0043168 | anion binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0003674 | molecular_function | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0017076 | purine nucleotide binding | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | 0.6297 | 0.1309 | 0.053 | 0.3002 | 0.2012 | 0.3552 | 0.3438 | 0.4861 | 0.3812 | 0.0285 |
| Orthofinder run ID | 4 |
| Orthogroup | 8993 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Ophiocordyceps subramaniannii | Hirsu2|2162 (this protein) |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|2162 MDEARQELHRIINDREMKDSLLLVFANKQDLQEAMKPQEVTEALQLSRLKDKVWYVVPSCATTGEGLLEGLAWLS NNVKAPPTPVKK* |
| Coding | >Hirsu2|2162 ATGGACGAGGCCCGCCAGGAGCTGCACCGCATCATCAACGACCGCGAGATGAAGGACAGCCTGCTGCTCGTCTTC GCCAACAAGCAGGACCTTCAGGAGGCCATGAAGCCGCAGGAGGTGACCGAGGCCCTGCAGCTGTCGCGCCTCAAG GACAAGGTCTGGTACGTCGTCCCCAGCTGCGCCACCACCGGCGAGGGCCTGCTCGAGGGCCTGGCCTGGCTGTCC AACAACGTCAAGGCCCCGCCCACGCCCGTCAAGAAGTAG |
| Transcript | >Hirsu2|2162 ATGGACGAGGCCCGCCAGGAGCTGCACCGCATCATCAACGACCGCGAGATGAAGGACAGCCTGCTGCTCGTCTTC GCCAACAAGCAGGACCTTCAGGAGGCCATGAAGCCGCAGGAGGTGACCGAGGCCCTGCAGCTGTCGCGCCTCAAG GACAAGGTCTGGTACGTCGTCCCCAGCTGCGCCACCACCGGCGAGGGCCTGCTCGAGGGCCTGGCCTGGCTGTCC AACAACGTCAAGGCCCCGCCCACGCCCGTCAAGAAGTAG |
| Gene | >Hirsu2|2162 ATGGACGAGGCCCGCCAGGAGCTGCACCGCATCATCAACGACCGCGAGATGAAGGACAGCCTGCTGCTCGTCTTC GCCAACAAGCAGGACCTTCAGGAGGCCATGAAGCCGCAGGAGGTGACCGAGGCCCTGCAGCTGTCGCGCCTCAAG GACAAGGTCTGGTACGTCGTCCCCAGCTGCGCCACCACCGGCGAGGGCCTGCTCGAGGGCCTGGCCTGGCTGTCC AACAACGTCAAGGCCCCGCCCACGCCCGTCAAGAAGTAG |