Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2161
Gene name
LocationContig_150:12166..13129
Strand-
Gene length (bp)963
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.0E-10 61 133

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87179|WSC1_SCHPO Cell wall integrity and stress response component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wsc1 PE=1 SV=3 207 300 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 207 229 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2161
MRCSTIACAALLAAAQACGAADSPTHLVVDKRATLVQRQENDPPKQSPSTFPRPNAPTSHGCYKSAGNMTTHNVE
NMSSGSCNEKCKSGKFSVSGLQGPNCFCGFAYPPDNAVVDDKKCGYPCPSYPLEACGGLGQPGFWSVFNTGVNVN
PPTYDEASSTSSSASQPTSPPKSDDPDRPAPTAVQSPDSPPPSSPPPDNKGGAKTGGIVAGCVAAAVVALLIGAA
IFFFVRRKRNAEIEEEHRRNAAVNAFINGSKPPGSSGSISMTDARLDPVLANRRMSDGSIADNEDYSRRILRVTN
A*
Coding >Hirsu2|2161
ATGCGGTGCTCGACAATCGCCTGCGCCGCCCTGCTGGCGGCGGCACAAGCCTGCGGCGCCGCCGACTCGCCTACT
CACCTCGTCGTCGACAAGCGTGCCACTCTCGTCCAGCGCCAAGAAAACGACCCCCCGAAACAGAGCCCTTCGACG
TTTCCTCGGCCGAACGCGCCCACGTCCCATGGCTGCTACAAGTCGGCTGGCAACATGACGACGCACAATGTCGAG
AACATGTCGTCCGGCTCCTGCAACGAAAAGTGCAAGTCGGGCAAATTCTCCGTCTCGGGCCTCCAGGGCCCCAAC
TGCTTCTGTGGCTTTGCCTATCCGCCAGACAACGCCGTCGTCGACGACAAGAAATGCGGCTACCCATGTCCCTCG
TACCCCCTCGAAGCCTGCGGCGGACTCGGCCAGCCTGGCTTCTGGTCCGTCTTCAACACGGGCGTCAACGTCAAT
CCGCCGACCTACGACGAAGCCTCTTCCACCTCGTCGAGCGCGTCCCAGCCCACGAGTCCGCCCAAGTCGGACGAT
CCCGATCGTCCTGCGCCCACCGCCGTCCAGAGCCCGGACTCGCCCCCGCCGTCGAGTCCCCCGCCCGACAACAAG
GGCGGCGCCAAGACGGGTGGCATTGTGGCGGGCTGCGTCGCCGCCGCCGTCGTCGCCCTCCTCATCGGCGCCGCC
ATCTTCTTCTTCGTGCGACGGAAGCGCAACGCCGAGATCGAGGAGGAGCATCGCCGCAATGCCGCCGTCAATGCC
TTCATCAATGGCTCCAAGCCGCCGGGCAGCAGTGGAAGCATCTCCATGACCGACGCCCGGCTCGACCCCGTCCTG
GCCAACCGTCGCATGAGCGACGGCAGCATTGCCGACAACGAAGACTACTCGCGCAGGATCCTTCGGGTTACCAAT
GCATGA
Transcript >Hirsu2|2161
ATGCGGTGCTCGACAATCGCCTGCGCCGCCCTGCTGGCGGCGGCACAAGCCTGCGGCGCCGCCGACTCGCCTACT
CACCTCGTCGTCGACAAGCGTGCCACTCTCGTCCAGCGCCAAGAAAACGACCCCCCGAAACAGAGCCCTTCGACG
TTTCCTCGGCCGAACGCGCCCACGTCCCATGGCTGCTACAAGTCGGCTGGCAACATGACGACGCACAATGTCGAG
AACATGTCGTCCGGCTCCTGCAACGAAAAGTGCAAGTCGGGCAAATTCTCCGTCTCGGGCCTCCAGGGCCCCAAC
TGCTTCTGTGGCTTTGCCTATCCGCCAGACAACGCCGTCGTCGACGACAAGAAATGCGGCTACCCATGTCCCTCG
TACCCCCTCGAAGCCTGCGGCGGACTCGGCCAGCCTGGCTTCTGGTCCGTCTTCAACACGGGCGTCAACGTCAAT
CCGCCGACCTACGACGAAGCCTCTTCCACCTCGTCGAGCGCGTCCCAGCCCACGAGTCCGCCCAAGTCGGACGAT
CCCGATCGTCCTGCGCCCACCGCCGTCCAGAGCCCGGACTCGCCCCCGCCGTCGAGTCCCCCGCCCGACAACAAG
GGCGGCGCCAAGACGGGTGGCATTGTGGCGGGCTGCGTCGCCGCCGCCGTCGTCGCCCTCCTCATCGGCGCCGCC
ATCTTCTTCTTCGTGCGACGGAAGCGCAACGCCGAGATCGAGGAGGAGCATCGCCGCAATGCCGCCGTCAATGCC
TTCATCAATGGCTCCAAGCCGCCGGGCAGCAGTGGAAGCATCTCCATGACCGACGCCCGGCTCGACCCCGTCCTG
GCCAACCGTCGCATGAGCGACGGCAGCATTGCCGACAACGAAGACTACTCGCGCAGGATCCTTCGGGTTACCAAT
GCATGA
Gene >Hirsu2|2161
ATGCGGTGCTCGACAATCGCCTGCGCCGCCCTGCTGGCGGCGGCACAAGCCTGCGGCGCCGCCGACTCGCCTACT
CACCTCGTCGTCGACAAGCGTGCCACTCTCGTCCAGCGCCAAGAAAACGACCCCCCGAAACAGAGCCCTTCGACG
TTTCCTCGGCCGAACGCGCCCACGTCCCATGGCTGCTACAAGTCGGCTGGCAACATGACGACGCACAATGTCGAG
AACATGTCGTCCGGCTCCTGCAACGAAAAGTGCAAGTCGGGCAAATTCTCCGTCTCGGGCCTCCAGGGCCCCAAC
TGCTTCTGTGGCTTTGCCTATCCGCCAGACAACGCCGTCGTCGACGACAAGAAATGCGGCTACCCATGTCCCTCG
TACCCCCTCGAAGCCTGCGGCGGACTCGGCCAGCCTGGCTTCTGGTCCGTCTTCAACACGGGCGTCAACGTCAAT
CCGCCGACCTACGACGAAGCCTCTTCCACCTCGTCGAGCGCGTCCCAGCCCACGAGTCCGCCCAAGTCGGACGAT
CCCGATCGTCCTGCGCCCACCGCCGTCCAGAGCCCGGACTCGCCCCCGCCGTCGAGTCCCCCGCCCGACAACAAG
GGCGGCGCCAAGACGGGTGGCATTGTGGCGGGCTGCGTCGCCGCCGCCGTCGTCGCCCTCCTCATCGGCGCCGCC
ATCTTCTTCTTCGTGCGACGGAAGCGCAACGCCGAGATCGAGGAGGAGCATCGCCGCAATGCCGCCGTCAATGCC
TTCATCAATGGCTCCAAGCCGCCGGGCAGCAGTGGAAGCATCTCCATGACCGACGCCCGGCTCGACCCCGTCCTG
GCCAACCGTCGCATGAGCGACGGCAGCATTGCCGACAACGAAGACTACTCGCGCAGGATCCTTCGGGTATGATGC
CGCGCCCACCTTCCTGTCTGCCTTTTATCTGACCAAAGCTTCGCACAGGTTACCAATGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail