© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|216 |
| Gene name | |
| Location | Contig_1039:36..887 |
| Strand | + |
| Gene length (bp) | 851 |
| Transcript length (bp) | 768 |
| Coding sequence length (bp) | 768 |
| Protein length (aa) | 256 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00425 | Chorismate_bind | chorismate binding enzyme | 6.5E-74 | 1 | 224 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P00899|TRPE_YEAST | Anthranilate synthase component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP2 PE=1 SV=4 | 1 | 239 | 3.0E-119 |
| sp|O94582|TRPE_SCHPO | Probable anthranilate synthase component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp3 PE=1 SV=1 | 1 | 247 | 3.0E-107 |
| sp|O66849|TRPE_AQUAE | Anthranilate synthase component 1 OS=Aquifex aeolicus (strain VF5) GN=trpE PE=3 SV=1 | 1 | 237 | 1.0E-74 |
| sp|Q9Z4W7|TRPE_STRCO | Anthranilate synthase component 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpE PE=3 SV=1 | 1 | 236 | 6.0E-73 |
| sp|Q9X6J4|TRPE_GEOSE | Anthranilate synthase component 1 OS=Geobacillus stearothermophilus GN=trpE PE=3 SV=1 | 1 | 244 | 6.0E-72 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P00899|TRPE_YEAST | Anthranilate synthase component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP2 PE=1 SV=4 | 1 | 239 | 3.0E-119 |
| sp|O94582|TRPE_SCHPO | Probable anthranilate synthase component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp3 PE=1 SV=1 | 1 | 247 | 3.0E-107 |
| sp|O66849|TRPE_AQUAE | Anthranilate synthase component 1 OS=Aquifex aeolicus (strain VF5) GN=trpE PE=3 SV=1 | 1 | 237 | 1.0E-74 |
| sp|Q9Z4W7|TRPE_STRCO | Anthranilate synthase component 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpE PE=3 SV=1 | 1 | 236 | 6.0E-73 |
| sp|Q9X6J4|TRPE_GEOSE | Anthranilate synthase component 1 OS=Geobacillus stearothermophilus GN=trpE PE=3 SV=1 | 1 | 244 | 6.0E-72 |
| sp|P30526|TRPE_BACCA | Anthranilate synthase component 1 OS=Bacillus caldotenax GN=trpE PE=3 SV=1 | 1 | 239 | 8.0E-72 |
| sp|P20579|TRPE_PSEPU | Anthranilate synthase component 1 OS=Pseudomonas putida GN=trpE PE=3 SV=1 | 1 | 237 | 7.0E-70 |
| sp|P56995|TRPE_NEIMB | Anthranilate synthase component 1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpE PE=3 SV=1 | 1 | 237 | 5.0E-69 |
| sp|P14953|TRPE_CLOTM | Anthranilate synthase component 1 OS=Clostridium thermocellum GN=trpE PE=3 SV=1 | 1 | 238 | 5.0E-69 |
| sp|Q9S358|TRPE_NEIMF | Anthranilate synthase component 1 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpE PE=3 SV=1 | 1 | 237 | 6.0E-69 |
| sp|Q9XAZ0|TRPE_NEIMA | Anthranilate synthase component 1 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpE PE=3 SV=1 | 1 | 237 | 8.0E-69 |
| sp|Q08653|TRPE_THEMA | Anthranilate synthase component 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpE PE=3 SV=2 | 1 | 238 | 3.0E-68 |
| sp|Q9X7C5|TRPE_MYCLE | Anthranilate synthase component 1 OS=Mycobacterium leprae (strain TN) GN=trpE PE=3 SV=1 | 1 | 238 | 4.0E-67 |
| sp|P20580|TRPE_PSEAE | Anthranilate synthase component 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpE PE=1 SV=1 | 1 | 237 | 1.0E-66 |
| sp|P03963|TRPE_BACSU | Anthranilate synthase component 1 OS=Bacillus subtilis (strain 168) GN=trpE PE=3 SV=2 | 1 | 252 | 6.0E-66 |
| sp|P18267|TRPE_BACPU | Anthranilate synthase component 1 OS=Bacillus pumilus GN=trpE PE=3 SV=2 | 1 | 246 | 6.0E-66 |
| sp|Q58475|TRPE_METJA | Anthranilate synthase component 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpE PE=3 SV=1 | 1 | 234 | 1.0E-65 |
| sp|P21689|TRPE_PSESS | Anthranilate synthase component 1 OS=Pseudomonas savastanoi GN=trpE PE=3 SV=1 | 1 | 224 | 2.0E-65 |
| sp|P05378|TRPE_THET8 | Anthranilate synthase component 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpE PE=3 SV=1 | 1 | 236 | 3.0E-65 |
| sp|A0QX93|TRPE_MYCS2 | Anthranilate synthase component 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpE PE=1 SV=1 | 1 | 224 | 2.0E-64 |
| sp|Q9WW00|TRPE_NEIGO | Anthranilate synthase component 1 OS=Neisseria gonorrhoeae GN=trpE PE=3 SV=1 | 1 | 224 | 2.0E-64 |
| sp|Q5F8B4|TRPE_NEIG1 | Anthranilate synthase component 1 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpE PE=3 SV=1 | 1 | 224 | 2.0E-64 |
| sp|P28820|PABB_BACSU | Aminodeoxychorismate synthase component 1 OS=Bacillus subtilis (strain 168) GN=pabB PE=1 SV=1 | 1 | 237 | 8.0E-64 |
| sp|P21690|TRPE_SPIAU | Anthranilate synthase component 1 OS=Spirochaeta aurantia GN=trpE PE=3 SV=1 | 1 | 232 | 4.0E-63 |
| sp|P96556|TRPE_ARTGO | Anthranilate synthase component 1 OS=Arthrobacter globiformis GN=trpE PE=3 SV=1 | 1 | 239 | 4.0E-63 |
| sp|P9WFX3|TRPE_MYCTU | Anthranilate synthase component 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpE PE=1 SV=1 | 1 | 224 | 4.0E-62 |
| sp|P9WFX2|TRPE_MYCTO | Anthranilate synthase component 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpE PE=1 SV=1 | 1 | 224 | 4.0E-62 |
| sp|P67002|TRPE_MYCBO | Anthranilate synthase component 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trpE PE=3 SV=1 | 1 | 224 | 4.0E-62 |
| sp|Q5V213|TRPE2_HALMA | Anthranilate synthase component 1 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpE2 PE=3 SV=1 | 1 | 236 | 8.0E-62 |
| sp|P20170|TRPE_SYNY3 | Anthranilate synthase component 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpE PE=3 SV=2 | 1 | 232 | 2.0E-61 |
| sp|O27692|TRPE_METTH | Anthranilate synthase component 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpE PE=3 SV=1 | 1 | 235 | 4.0E-59 |
| sp|Q02001|TRPE_LACLA | Anthranilate synthase component 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpE PE=3 SV=2 | 1 | 224 | 2.0E-58 |
| sp|P23315|TRPE_ACICA | Anthranilate synthase component 1 OS=Acinetobacter calcoaceticus GN=trpE PE=3 SV=1 | 1 | 232 | 3.0E-57 |
| sp|P26940|TRPE_METTM | Anthranilate synthase component 1 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpE PE=3 SV=2 | 1 | 237 | 4.0E-57 |
| sp|P43761|TRPE_HAEIN | Anthranilate synthase component 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpE PE=3 SV=1 | 1 | 232 | 6.0E-57 |
| sp|A2XNK3|ASA1_ORYSI | Anthranilate synthase alpha subunit 1, chloroplastic OS=Oryza sativa subsp. indica GN=ASA1 PE=3 SV=1 | 1 | 242 | 1.0E-56 |
| sp|Q94GF1|ASA1_ORYSJ | Anthranilate synthase alpha subunit 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ASA1 PE=1 SV=1 | 1 | 242 | 2.0E-56 |
| sp|Q44689|TRPE_BUCRM | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Rhopalosiphum maidis GN=trpE PE=3 SV=1 | 1 | 235 | 2.0E-56 |
| sp|P42387|TRPE_BUCAP | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpE PE=3 SV=1 | 1 | 235 | 5.0E-56 |
| sp|P32069|TRPX_ARATH | Anthranilate synthase alpha subunit 2, chloroplastic OS=Arabidopsis thaliana GN=ASA2 PE=2 SV=1 | 1 | 241 | 5.0E-56 |
| sp|P95646|TRPE_RHOS4 | Anthranilate synthase component 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpE PE=3 SV=3 | 1 | 224 | 5.0E-56 |
| sp|Q44695|TRPE_BUCAI | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpE PE=3 SV=3 | 1 | 235 | 7.0E-56 |
| sp|Q9YGB3|TRPE_THEKO | Anthranilate synthase component 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpE PE=3 SV=1 | 1 | 236 | 8.0E-56 |
| sp|Q44691|TRPE_BUCRP | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=trpE PE=3 SV=1 | 1 | 235 | 9.0E-56 |
| sp|Q06128|TRPE_SULSO | Anthranilate synthase component 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpE PE=1 SV=2 | 1 | 227 | 3.0E-55 |
| sp|Q44697|TRPE_BUCDN | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpE PE=3 SV=1 | 1 | 238 | 4.0E-55 |
| sp|P74130|TRE2_SYNY3 | Anthranilate synthase component I-like protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpE2 PE=3 SV=1 | 1 | 227 | 9.0E-55 |
| sp|P00895|TRPE_ECOLI | Anthranilate synthase component 1 OS=Escherichia coli (strain K12) GN=trpE PE=1 SV=2 | 1 | 235 | 1.0E-54 |
| sp|P00898|TRPE_SALTY | Anthranilate synthase component 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpE PE=1 SV=3 | 1 | 237 | 2.0E-54 |
| sp|Q89A29|TRPE_BUCBP | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpE PE=3 SV=1 | 1 | 235 | 4.0E-54 |
| sp|P32068|TRPE_ARATH | Anthranilate synthase alpha subunit 1, chloroplastic OS=Arabidopsis thaliana GN=ASA1 PE=1 SV=1 | 1 | 242 | 6.0E-54 |
| sp|P22099|TRPE_VIBPA | Anthranilate synthase component 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpE PE=3 SV=2 | 1 | 235 | 8.0E-54 |
| sp|Q9Y8T0|TRPE_AERPE | Anthranilate synthase component 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpE PE=3 SV=2 | 1 | 227 | 8.0E-54 |
| sp|Q44598|TRPE_BUCSC | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=trpE PE=3 SV=1 | 1 | 241 | 1.0E-53 |
| sp|P06557|TRPE_CORGL | Anthranilate synthase component 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpE PE=3 SV=2 | 1 | 235 | 2.0E-53 |
| sp|P33975|TRPE_HALVD | Anthranilate synthase component 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpE PE=3 SV=2 | 1 | 246 | 6.0E-53 |
| sp|O28669|TRPE_ARCFU | Anthranilate synthase component 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpE PE=3 SV=1 | 1 | 232 | 1.0E-52 |
| sp|Q9KST2|TRPE_VIBCH | Anthranilate synthase component 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpE PE=3 SV=1 | 1 | 237 | 2.0E-52 |
| sp|Q9XJ29|ASA2_ORYSJ | Anthranilate synthase alpha subunit 2, chloroplastic OS=Oryza sativa subsp. japonica GN=OsASA2 PE=1 SV=1 | 1 | 243 | 6.0E-52 |
| sp|Q9HPG5|TRPE1_HALSA | Anthranilate synthase component 1 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpE1 PE=3 SV=1 | 1 | 232 | 8.0E-52 |
| sp|Q9ZER9|TRPE_BUCPS | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=trpE PE=3 SV=1 | 1 | 235 | 2.0E-51 |
| sp|Q9ZJU5|TRPE_HELPJ | Anthranilate synthase component 1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpE PE=3 SV=1 | 1 | 232 | 5.0E-51 |
| sp|O25869|TRPE_HELPY | Anthranilate synthase component 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpE PE=3 SV=1 | 1 | 221 | 1.0E-50 |
| sp|Q9ZES2|TRPE_BUCTC | Anthranilate synthase component 1 OS=Buchnera aphidicola subsp. Tetraneura caerulescens GN=trpE PE=3 SV=1 | 1 | 232 | 4.0E-50 |
| sp|Q5V448|TRPE1_HALMA | Anthranilate synthase component 1 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpE1 PE=3 SV=1 | 1 | 235 | 2.0E-49 |
| sp|P00897|TRPE_SERMA | Anthranilate synthase component 1 OS=Serratia marcescens GN=trpE PE=1 SV=2 | 1 | 237 | 8.0E-49 |
| sp|P12680|PABB_SALTY | Aminodeoxychorismate synthase component 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pabB PE=3 SV=1 | 1 | 226 | 2.0E-47 |
| sp|Q5V631|TRPE3_HALMA | Anthranilate synthase component 1 3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpE3 PE=3 SV=2 | 1 | 235 | 5.0E-46 |
| sp|P09785|PHNA_PSEAE | Anthranilate synthase component 1, pyocyanine specific OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnA PE=1 SV=2 | 5 | 224 | 5.0E-46 |
| sp|Q8GMH4|SGCD_STRGL | 2-amino-4-deoxychorismate synthase OS=Streptomyces globisporus GN=sgcD PE=1 SV=1 | 1 | 238 | 7.0E-46 |
| sp|P12679|PABB_ENTAE | Aminodeoxychorismate synthase component 1 OS=Enterobacter aerogenes GN=pabB PE=3 SV=1 | 1 | 234 | 3.0E-45 |
| sp|P20463|TRPE_LEPBI | Anthranilate synthase component 1 OS=Leptospira biflexa GN=trpE PE=3 SV=1 | 1 | 227 | 1.0E-44 |
| sp|P05041|PABB_ECOLI | Aminodeoxychorismate synthase component 1 OS=Escherichia coli (strain K12) GN=pabB PE=1 SV=1 | 1 | 226 | 1.0E-44 |
| sp|P27630|PABB_STRLI | Aminodeoxychorismate synthase component 1 OS=Streptomyces lividans GN=pabB PE=3 SV=1 | 1 | 224 | 3.0E-44 |
| sp|Q6TAS3|ADCS_SOLLC | Aminodeoxychorismate synthase, chloroplastic OS=Solanum lycopersicum GN=ADCS PE=2 SV=1 | 1 | 246 | 2.0E-42 |
| sp|Q5Z856|ADCS_ORYSJ | Probable aminodeoxychorismate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=ADCS PE=2 SV=1 | 1 | 253 | 9.0E-42 |
| sp|Q9HS66|TRPE2_HALSA | Anthranilate synthase component 1 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpE2 PE=3 SV=1 | 1 | 235 | 1.0E-41 |
| sp|Q8LPN3|ADCS_ARATH | Aminodeoxychorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=ADCS PE=1 SV=1 | 1 | 227 | 3.0E-41 |
| sp|P27629|PABB_LACLL | Aminodeoxychorismate synthase component 1 OS=Lactococcus lactis subsp. lactis GN=pabB PE=3 SV=1 | 1 | 227 | 5.0E-41 |
| sp|P32483|PABS_STRGR | Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 | 1 | 235 | 7.0E-40 |
| sp|P15395|TRPE_RHIME | Anthranilate synthase OS=Rhizobium meliloti (strain 1021) GN=trpE(G) PE=3 SV=1 | 1 | 213 | 2.0E-37 |
| sp|P50872|TRPE_AZOBR | Anthranilate synthase OS=Azospirillum brasilense GN=trpE(G) PE=3 SV=1 | 1 | 232 | 1.0E-33 |
| sp|Q73XV3|MBTI_MYCPA | Salicylate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtI PE=3 SV=1 | 11 | 225 | 8.0E-28 |
| sp|Q51508|PCHA_PSEAE | Salicylate biosynthesis isochorismate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pchA PE=1 SV=1 | 1 | 234 | 1.0E-22 |
| sp|Q57527|Y1170_HAEIN | Uncharacterized PabA-like protein HI_1170 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1170 PE=4 SV=1 | 7 | 225 | 2.0E-22 |
| sp|O94277|PABS_SCHPO | Putative aminodeoxychorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.29 PE=3 SV=1 | 2 | 224 | 6.0E-22 |
| sp|P9WFX1|MBTI_MYCTU | Salicylate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtI PE=1 SV=1 | 11 | 225 | 2.0E-21 |
| sp|P9WFX0|MBTI_MYCTO | Salicylate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtI PE=3 SV=1 | 11 | 225 | 2.0E-21 |
| sp|Q7TYQ1|MBTI_MYCBO | Salicylate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtI PE=3 SV=1 | 11 | 225 | 2.0E-21 |
| sp|P23973|MENF_BACSU | Isochorismate synthase MenF OS=Bacillus subtilis (strain 168) GN=menF PE=3 SV=2 | 7 | 225 | 1.0E-20 |
| sp|Q9CKY6|Y1464_PASMU | Uncharacterized PabA-like protein PM1464 OS=Pasteurella multocida (strain Pm70) GN=PM1464 PE=4 SV=1 | 7 | 225 | 7.0E-20 |
| sp|P9WFW9|MENF_MYCTU | Putative isochorismate synthase MenF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menF PE=1 SV=1 | 20 | 232 | 1.0E-19 |
| sp|P9WFW8|MENF_MYCTO | Putative isochorismate synthase MenF OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menF PE=3 SV=1 | 20 | 232 | 1.0E-19 |
| sp|Q9S7H8|ICS1_ARATH | Isochorismate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=ICS1 PE=1 SV=2 | 20 | 232 | 9.0E-19 |
| sp|Q9ZPC0|ICS_CATRO | Isochorismate synthase, chloroplastic OS=Catharanthus roseus PE=1 SV=1 | 20 | 220 | 1.0E-18 |
| sp|Q9M9V6|ICS2_ARATH | Isochorismate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=ICS2 PE=2 SV=2 | 20 | 220 | 1.0E-17 |
| sp|P37254|PABS_YEAST | Aminodeoxychorismate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABZ1 PE=1 SV=4 | 5 | 230 | 4.0E-15 |
| sp|P45744|DHBC_BACSU | Isochorismate synthase DhbC OS=Bacillus subtilis (strain 168) GN=dhbC PE=1 SV=2 | 20 | 225 | 8.0E-14 |
| sp|P0AEJ2|ENTC_ECOLI | Isochorismate synthase EntC OS=Escherichia coli (strain K12) GN=entC PE=1 SV=1 | 5 | 232 | 3.0E-13 |
| sp|P0AEJ3|ENTC_ECO57 | Isochorismate synthase EntC OS=Escherichia coli O157:H7 GN=entC PE=3 SV=1 | 5 | 232 | 3.0E-13 |
| sp|Q9CPI5|MENF_PASMU | Isochorismate synthase MenF OS=Pasteurella multocida (strain Pm70) GN=menF PE=3 SV=1 | 20 | 224 | 6.0E-13 |
| sp|P23300|AMOA_AERHY | Putative isochorismate synthase OS=Aeromonas hydrophila GN=amoA PE=3 SV=1 | 1 | 232 | 1.0E-12 |
| sp|P38051|MENF_ECOLI | Isochorismate synthase MenF OS=Escherichia coli (strain K12) GN=menF PE=1 SV=4 | 2 | 224 | 2.0E-12 |
| sp|O07898|VIBC_VIBCH | Vibriobactin-specific isochorismate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibC PE=3 SV=1 | 19 | 235 | 2.0E-12 |
| sp|P44613|MENF_HAEIN | Isochorismate synthase MenF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menF PE=3 SV=1 | 20 | 220 | 1.0E-11 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm|Mitochondrion | Mitochondrial transit peptide|Peroxisomal targeting signal | 0.5762 | 0.3119 | 0.0735 | 0.1979 | 0.8633 | 0.118 | 0.2876 | 0.2311 | 0.1898 | 0.3557 |
| Orthofinder run ID | 4 |
| Orthogroup | 748 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|216 LRTVNPSPYLFYLDCRDFQIVGASPELLVRNEGPGGRRVVTHPIAGTVGRGATPADDARLADELRGSLKDRAEHV MLVDLARNDVNRVADPLTVRVDRLMAVERFSHVQHLVSQVSGLLRPGKTRFDAFRSIFPAGTVSGAPKVRAMELI AELEREKRGVYAGAVGYFGYGAEDADGNLAEGPMDTCIALRTMLVKDGVAYLQAGGGIVFDSDEHDEWQETINKL GANMQCIASAEELYYQQQQQQAARAKTATQ* |
| Coding | >Hirsu2|216 CTGCGGACCGTCAACCCGTCGCCCTACCTCTTCTACCTCGACTGCCGCGACTTCCAGATCGTCGGCGCCTCGCCC GAGCTGCTCGTCCGCAACGAGGGGCCGGGCGGCCGCCGCGTCGTGACCCACCCGATCGCCGGCACCGTCGGCCGC GGCGCCACCCCCGCCGACGACGCCCGCCTGGCCGACGAGCTGCGCGGCTCGCTCAAGGACCGCGCCGAGCACGTC ATGCTCGTCGACCTGGCCCGCAACGACGTCAACCGCGTCGCCGACCCGCTCACCGTCCGCGTCGACCGCCTCATG GCCGTCGAGCGCTTCAGCCACGTCCAGCACCTCGTCTCCCAGGTCTCGGGCCTCCTGCGGCCCGGCAAGACCCGC TTCGACGCCTTCCGCTCCATCTTCCCCGCCGGCACCGTCTCCGGCGCGCCCAAGGTCCGCGCCATGGAGCTCATC GCCGAGCTCGAGCGCGAGAAGCGCGGCGTCTACGCCGGCGCCGTCGGCTACTTCGGCTACGGCGCCGAGGACGCC GACGGCAACCTCGCCGAGGGCCCCATGGACACCTGCATCGCCCTCCGCACCATGCTCGTCAAGGACGGCGTCGCC TATCTCCAAGCAGGCGGAGGCATCGTCTTCGACTCGGACGAGCACGACGAGTGGCAGGAGACCATCAACAAGCTG GGCGCCAACATGCAGTGCATCGCCTCCGCCGAGGAGCTCTACTACCAGCAGCAGCAGCAGCAGGCCGCACGGGCC AAGACGGCGACGCAATGA |
| Transcript | >Hirsu2|216 CTGCGGACCGTCAACCCGTCGCCCTACCTCTTCTACCTCGACTGCCGCGACTTCCAGATCGTCGGCGCCTCGCCC GAGCTGCTCGTCCGCAACGAGGGGCCGGGCGGCCGCCGCGTCGTGACCCACCCGATCGCCGGCACCGTCGGCCGC GGCGCCACCCCCGCCGACGACGCCCGCCTGGCCGACGAGCTGCGCGGCTCGCTCAAGGACCGCGCCGAGCACGTC ATGCTCGTCGACCTGGCCCGCAACGACGTCAACCGCGTCGCCGACCCGCTCACCGTCCGCGTCGACCGCCTCATG GCCGTCGAGCGCTTCAGCCACGTCCAGCACCTCGTCTCCCAGGTCTCGGGCCTCCTGCGGCCCGGCAAGACCCGC TTCGACGCCTTCCGCTCCATCTTCCCCGCCGGCACCGTCTCCGGCGCGCCCAAGGTCCGCGCCATGGAGCTCATC GCCGAGCTCGAGCGCGAGAAGCGCGGCGTCTACGCCGGCGCCGTCGGCTACTTCGGCTACGGCGCCGAGGACGCC GACGGCAACCTCGCCGAGGGCCCCATGGACACCTGCATCGCCCTCCGCACCATGCTCGTCAAGGACGGCGTCGCC TATCTCCAAGCAGGCGGAGGCATCGTCTTCGACTCGGACGAGCACGACGAGTGGCAGGAGACCATCAACAAGCTG GGCGCCAACATGCAGTGCATCGCCTCCGCCGAGGAGCTCTACTACCAGCAGCAGCAGCAGCAGGCCGCACGGGCC AAGACGGCGACGCAATGA |
| Gene | >Hirsu2|216 CTGCGGACCGTCAACCCGTCGCCCTACCTCTTCTACCTCGACTGCCGCGACTTCCAGATCGTCGGCGCCTCGCCC GAGCTGCTCGTCCGCAACGAGGGGCCGGGCGGCCGCCGCGTCGTGACCCACCCGATCGCCGGCACCGTCGGCCGC GGCGCCACCCCCGCCGACGACGCCCGCCTGGCCGACGAGCTGCGCGGCTCGCTCAAGGACCGCGCCGAGCACGTC ATGCTCGTCGACCTGGCCCGCAACGACGTCAACCGCGTCGCCGACCCGCTCACCGTCCGCGTCGACCGCCTCATG GCCGTCGAGCGCTTCAGCCACGTCCAGCACCTCGTCTCCCAGGTCTCGGGCCTCCTGCGGCCCGGCAAGACCCGC TTCGACGCCTTCCGCTCCATCTTCCCCGCCGGCACCGTCTCCGGCGCGCCCAAGGTCCGCGCCATGGAGCTCATC GCCGAGCTCGAGCGCGAGAAGCGCGGCGTCTACGCCGGCGCCGTCGGCTACTTCGGCTACGGCGCCGAGGACGCC GACGGCAACCTCGCCGAGGGCCCCATGGACACCTGCATCGCCCTCCGCACCATGCTCGTCAAGGACGGCGTCGCC TATCTCCAAGCAGGTCCGCTTCTTCCCCCCCCTCTTCTTCTTTTCCTCCTCTGCTGCCTGCCCCTTCGGCGCCCG CTGACCCGCCGACGGAAACAGGCGGAGGCATCGTCTTCGACTCGGACGAGCACGACGAGTGGCAGGAGACCATCA ACAAGCTGGGCGCCAACATGCAGTGCATCGCCTCCGCCGAGGAGCTCTACTACCAGCAGCAGCAGCAGCAGGCCG CACGGGCCAAGACGGCGACGCAATGA |