Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2158
Gene name
LocationContig_150:2791..4767
Strand-
Gene length (bp)1976
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain 9.5E-44 371 527
PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain 2.4E-21 137 261
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 4.8E-20 6 77
PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain 1.1E-19 265 359
PF08028 Acyl-CoA_dh_2 Acyl-CoA dehydrogenase, C-terminal domain 9.2E-10 395 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P45857|ACDB_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgC PE=2 SV=3 135 519 1.0E-43
sp|P34275|IVD_CAEEL Probable acyl-CoA dehydrogenase 6 OS=Caenorhabditis elegans GN=acdh-6 PE=3 SV=2 136 531 4.0E-40
sp|C3UVB0|ACD_DESML Glutaryl-CoA dehydrogenase OS=Desulfococcus multivorans GN=Acd PE=1 SV=1 143 519 8.0E-40
sp|P45867|ACDA_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=acdA PE=2 SV=1 136 519 1.0E-39
sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acads PE=1 SV=2 128 519 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P45857|ACDB_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgC PE=2 SV=3 135 519 1.0E-43
sp|P34275|IVD_CAEEL Probable acyl-CoA dehydrogenase 6 OS=Caenorhabditis elegans GN=acdh-6 PE=3 SV=2 136 531 4.0E-40
sp|C3UVB0|ACD_DESML Glutaryl-CoA dehydrogenase OS=Desulfococcus multivorans GN=Acd PE=1 SV=1 143 519 8.0E-40
sp|P45867|ACDA_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=acdA PE=2 SV=1 136 519 1.0E-39
sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acads PE=1 SV=2 128 519 1.0E-38
sp|P15651|ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acads PE=1 SV=2 128 519 3.0E-38
sp|P52042|ACDS_CLOAB Acyl-CoA dehydrogenase, short-chain specific OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bcd PE=1 SV=1 136 519 4.0E-38
sp|Q2LQP0|CHCOA_SYNAS Cyclohexane-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) GN=SYN_02586 PE=1 SV=1 147 519 4.0E-38
sp|Q5RBD5|IVD_PONAB Isovaleryl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=IVD PE=2 SV=1 136 519 8.0E-38
sp|O32176|FADE_BACSU Probable acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=fadE PE=2 SV=1 124 519 5.0E-37
sp|P26440|IVD_HUMAN Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=IVD PE=1 SV=1 136 519 5.0E-37
sp|P79274|ACADL_PIG Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADL PE=2 SV=1 136 527 7.0E-37
sp|P28330|ACADL_HUMAN Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADL PE=1 SV=2 136 527 1.0E-36
sp|P51174|ACADL_MOUSE Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadl PE=1 SV=2 136 527 1.0E-36
sp|Q06319|ACDS_MEGEL Acyl-CoA dehydrogenase, short-chain specific OS=Megasphaera elsdenii PE=1 SV=1 152 521 2.0E-36
sp|Q9JHI5|IVD_MOUSE Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Ivd PE=1 SV=1 136 519 4.0E-36
sp|P12007|IVD_RAT Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Ivd PE=1 SV=2 136 519 5.0E-36
sp|Q60HI0|ACADL_MACFA Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=ACADL PE=2 SV=1 136 527 9.0E-36
sp|P9WQG1|ACDP_MYCTU Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadE25 PE=1 SV=1 138 530 1.0E-35
sp|P9WQG0|ACDP_MYCTO Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadE25 PE=3 SV=1 138 530 1.0E-35
sp|P63428|ACDP_MYCBO Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadE25 PE=3 SV=1 138 530 1.0E-35
sp|Q5RAS0|ACADS_PONAB Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=ACADS PE=2 SV=1 126 519 2.0E-35
sp|Q3SZI8|IVD_BOVIN Isovaleryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=IVD PE=2 SV=1 136 519 4.0E-35
sp|P16219|ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADS PE=1 SV=1 126 519 6.0E-35
sp|P79273|ACADS_PIG Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADS PE=2 SV=1 128 519 1.0E-34
sp|Q75IM9|IVD_ORYSJ Isovaleryl-CoA dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=Os05g0125500 PE=2 SV=2 128 519 2.0E-34
sp|P15650|ACADL_RAT Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadl PE=1 SV=1 136 527 2.0E-34
sp|Q9H845|ACAD9_HUMAN Acyl-CoA dehydrogenase family member 9, mitochondrial OS=Homo sapiens GN=ACAD9 PE=1 SV=1 156 520 2.0E-34
sp|Q3ZBF6|ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADS PE=1 SV=1 128 519 1.0E-33
sp|O34421|ACDC_BACSU Probable acyl-CoA dehydrogenase YngJ OS=Bacillus subtilis (strain 168) GN=yngJ PE=3 SV=1 143 530 2.0E-33
sp|P46703|ACDP_MYCLE Probable acyl-CoA dehydrogenase fadE25 OS=Mycobacterium leprae (strain TN) GN=fadE25 PE=3 SV=1 133 530 1.0E-32
sp|Q9FS87|IVD_SOLTU Isovaleryl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum GN=IVD PE=1 SV=2 125 519 2.0E-32
sp|G3KIM8|ACRC_CLOPR Acryloyl-CoA reductase (NADH) OS=Clostridium propionicum GN=acrC PE=1 SV=1 143 530 5.0E-32
sp|A8XNF0|ACAD1_CAEBR Probable medium-chain specific acyl-CoA dehydrogenase 1, mitochondrial OS=Caenorhabditis briggsae GN=CBG15946 PE=3 SV=1 136 519 6.0E-32
sp|Q3SZB4|ACADM_BOVIN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADM PE=2 SV=1 136 529 2.0E-31
sp|P11310|ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADM PE=1 SV=1 136 529 2.0E-31
sp|Q5EAD4|ACDSB_BOVIN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADSB PE=2 SV=1 136 522 2.0E-31
sp|Q22347|ACADM_CAEEL Probable medium-chain specific acyl-CoA dehydrogenase 10, mitochondrial OS=Caenorhabditis elegans GN=acdh-10 PE=2 SV=1 136 519 2.0E-31
sp|Q9SWG0|IVD_ARATH Isovaleryl-CoA dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=IVD PE=1 SV=2 137 519 3.0E-31
sp|A5A6I0|ACADM_PANTR Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pan troglodytes GN=ACADM PE=2 SV=1 136 529 3.0E-31
sp|Q9FS88|MBCD_SOLTU 2-methylacyl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum GN=2MBCD PE=1 SV=2 133 519 4.0E-31
sp|Q8HXY8|ACADM_MACFA Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=ACADM PE=2 SV=1 136 529 6.0E-31
sp|Q9VSA3|ACADM_DROME Probable medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG12262 PE=1 SV=1 136 533 8.0E-31
sp|Q8JZN5|ACAD9_MOUSE Acyl-CoA dehydrogenase family member 9, mitochondrial OS=Mus musculus GN=Acad9 PE=1 SV=2 145 520 6.0E-30
sp|Q54IM8|ACAD8_DICDI Isobutyryl-CoA dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=acad8 PE=3 SV=1 136 520 7.0E-30
sp|P45952|ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadm PE=1 SV=1 136 529 1.0E-29
sp|Q0NXR6|ACAD8_BOVIN Isobutyryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACAD8 PE=2 SV=1 154 530 1.0E-29
sp|P41367|ACADM_PIG Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADM PE=1 SV=3 120 529 1.0E-29
sp|P08503|ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadm PE=1 SV=1 136 529 2.0E-29
sp|P0A9U8|YDIO_ECOLI Probable acyl-CoA dehydrogenase YdiO OS=Escherichia coli (strain K12) GN=ydiO PE=3 SV=1 136 530 2.0E-29
sp|P0A9U9|YDIO_ECOL6 Probable acyl-CoA dehydrogenase YdiO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydiO PE=3 SV=1 136 530 2.0E-29
sp|P0A9V0|YDIO_ECO57 Probable acyl-CoA dehydrogenase YdiO OS=Escherichia coli O157:H7 GN=ydiO PE=3 SV=1 136 530 2.0E-29
sp|P70584|ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadsb PE=1 SV=1 136 522 2.0E-29
sp|A8WP91|ACAD2_CAEBR Probable medium-chain specific acyl-CoA dehydrogenase 2, mitochondrial OS=Caenorhabditis briggsae GN=CBG00953 PE=3 SV=2 136 435 7.0E-29
sp|Q8HXY7|ACADV_MACFA Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=ACADVL PE=2 SV=1 76 520 8.0E-29
sp|Q9UKU7|ACAD8_HUMAN Isobutyryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACAD8 PE=1 SV=1 136 530 1.0E-28
sp|P50544|ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadvl PE=1 SV=3 236 520 2.0E-28
sp|Q9D7B6|ACAD8_MOUSE Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acad8 PE=1 SV=2 136 530 3.0E-28
sp|P49748|ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADVL PE=1 SV=1 76 520 5.0E-28
sp|P45953|ACADV_RAT Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadvl PE=1 SV=1 236 520 2.0E-27
sp|Q9DBL1|ACDSB_MOUSE Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadsb PE=1 SV=1 143 522 2.0E-27
sp|Q5RF40|ACDSB_PONAB Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=ACADSB PE=2 SV=1 136 522 4.0E-27
sp|P45954|ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1 136 522 4.0E-27
sp|P48818|ACADV_BOVIN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADVL PE=2 SV=3 236 520 2.0E-26
sp|B7M0D6|CAIA_ECO8A Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=caiA PE=3 SV=1 136 521 6.0E-26
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 1 82 1.0E-25
sp|Q0T8F5|CAIA_SHIF8 Crotonobetainyl-CoA dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiA PE=3 SV=1 217 521 1.0E-25
sp|Q3Z5W9|CAIA_SHISS Crotonobetainyl-CoA dehydrogenase OS=Shigella sonnei (strain Ss046) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|P60587|CAIA_SHIFL Crotonobetainyl-CoA dehydrogenase OS=Shigella flexneri GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|Q32K58|CAIA_SHIDS Crotonobetainyl-CoA dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B7LWN0|CAIA_ESCF3 Crotonobetainyl-CoA dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|Q1RGF9|CAIA_ECOUT Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B1LFX2|CAIA_ECOSM Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B6HYZ0|CAIA_ECOSE Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain SE11) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B7N7R4|CAIA_ECOLU Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|P60584|CAIA_ECOLI Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain K12) GN=caiA PE=1 SV=1 136 521 2.0E-25
sp|B1IRD7|CAIA_ECOLC Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|P60585|CAIA_ECOL6 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|A1A789|CAIA_ECOK1 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|A7ZVY9|CAIA_ECOHS Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B1XBG4|CAIA_ECODH Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|C4ZPW5|CAIA_ECOBW Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B7MNP6|CAIA_ECO81 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B7NHE3|CAIA_ECO7I Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B5YYD3|CAIA_ECO5E Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|P60586|CAIA_ECO57 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O157:H7 GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B7L4G2|CAIA_ECO55 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B7MAG2|CAIA_ECO45 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B7UI85|CAIA_ECO27 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|A7ZHD0|CAIA_ECO24 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|Q8ZRX2|CAIA_SALTY Crotonobetainyl-CoA dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B4TWR6|CAIA_SALSV Crotonobetainyl-CoA dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B5BL57|CAIA_SALPK Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|C0Q4L5|CAIA_SALPC Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|A9MYJ9|CAIA_SALPB Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|Q5PIN6|CAIA_SALPA Crotonobetainyl-CoA dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B4T6J8|CAIA_SALNS Crotonobetainyl-CoA dehydrogenase OS=Salmonella newport (strain SL254) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B4TIH2|CAIA_SALHS Crotonobetainyl-CoA dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B5RGA6|CAIA_SALG2 Crotonobetainyl-CoA dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B5R1R2|CAIA_SALEP Crotonobetainyl-CoA dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B5FHG7|CAIA_SALDC Crotonobetainyl-CoA dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|Q57TI8|CAIA_SALCH Crotonobetainyl-CoA dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|B5F752|CAIA_SALA4 Crotonobetainyl-CoA dehydrogenase OS=Salmonella agona (strain SL483) GN=caiA PE=3 SV=1 136 521 2.0E-25
sp|Q0TLV0|CAIA_ECOL5 Crotonobetainyl-CoA dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiA PE=3 SV=1 217 521 2.0E-25
sp|Q8Z9L2|CAIA_SALTI Crotonobetainyl-CoA dehydrogenase OS=Salmonella typhi GN=caiA PE=3 SV=1 136 521 3.0E-25
sp|A9MQH5|CAIA_SALAR Crotonobetainyl-CoA dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiA PE=3 SV=1 136 521 7.0E-25
sp|A8ALR4|CAIA_CITK8 Crotonobetainyl-CoA dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiA PE=3 SV=1 136 521 7.0E-25
sp|Q8GB20|CAIA_PROSL Crotonobetainyl-CoA dehydrogenase OS=Proteus sp. (strain LE138) GN=caiA PE=3 SV=1 217 521 2.0E-24
sp|B4EY23|CAIA_PROMH Crotonobetainyl-CoA dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=caiA PE=3 SV=1 217 521 2.0E-24
sp|Q2LQN9|CH1CO_SYNAS Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) GN=SYN_02587 PE=1 SV=1 136 519 4.0E-23
sp|Q20772|GCDH_CAEEL Probable glutaryl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=F54D5.7 PE=1 SV=1 133 434 4.0E-22
sp|Q54R47|GCDH_DICDI Glutaryl-CoA dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=gcdh PE=3 SV=1 117 434 3.0E-21
sp|P63430|Y897_MYCBO Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadE10 PE=3 SV=1 115 529 2.0E-20
sp|P9WQF7|Y873_MYCTU Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadE10 PE=1 SV=1 115 529 2.0E-20
sp|P9WQF6|Y873_MYCTO Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadE10 PE=3 SV=1 115 529 2.0E-20
sp|Q8HXX8|GCDH_MACFA Glutaryl-CoA dehydrogenase, mitochondrial OS=Macaca fascicularis GN=GCDH PE=2 SV=1 143 488 3.0E-20
sp|Q92947|GCDH_HUMAN Glutaryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=GCDH PE=1 SV=1 143 488 5.0E-20
sp|Q2KHZ9|GCDH_BOVIN Glutaryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=GCDH PE=2 SV=1 143 488 1.0E-19
sp|P81140|GCDH_PIG Glutaryl-CoA dehydrogenase, mitochondrial (Fragment) OS=Sus scrofa GN=GCDH PE=1 SV=1 143 488 8.0E-18
sp|Q60759|GCDH_MOUSE Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Gcdh PE=1 SV=2 143 488 6.0E-17
sp|Q54RR5|ACDSB_DICDI Probable short/branched chain specific acyl-CoA dehydrogenase OS=Dictyostelium discoideum GN=acadsb PE=3 SV=1 129 521 1.0E-16
sp|P9WQG3|ACDC_MYCTU Acyl-CoA dehydrogenase fadE12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadE12 PE=1 SV=1 137 435 5.0E-15
sp|P9WQG2|ACDC_MYCTO Acyl-CoA dehydrogenase fadE12 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadE12 PE=3 SV=1 137 435 5.0E-15
sp|Q7U0Y2|ACDC_MYCBO Acyl-CoA dehydrogenase fadE12 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadE12 PE=3 SV=1 137 435 6.0E-15
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 1 94 1.0E-14
sp|Q96329|ACOX4_ARATH Acyl-coenzyme A oxidase 4, peroxisomal OS=Arabidopsis thaliana GN=ACX4 PE=1 SV=1 125 475 7.0E-14
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 3 103 9.0E-14
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 3 106 1.0E-13
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 2 111 2.0E-13
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 1 101 4.0E-13
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 1 56 9.0E-13
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 2 111 1.0E-12
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 1 84 1.0E-12
sp|P33224|AIDB_ECOLI Putative acyl-CoA dehydrogenase AidB OS=Escherichia coli (strain K12) GN=aidB PE=1 SV=3 240 520 1.0E-12
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 2 111 2.0E-12
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 2 107 2.0E-12
sp|Q73ZP8|MBTN_MYCPA Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtN PE=3 SV=1 148 523 3.0E-12
sp|Q9KJE8|BBSG_THAAR (R)-benzylsuccinyl-CoA dehydrogenase OS=Thauera aromatica GN=bbsG PE=1 SV=1 208 519 1.0E-11
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 3 111 4.0E-11
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 5 68 9.0E-11
sp|Q8RWZ3|IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana GN=IBR3 PE=1 SV=1 241 521 2.0E-10
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 3 83 2.0E-10
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 5 70 2.0E-10
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 3 83 3.0E-10
sp|Q6JQN1|ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens GN=ACAD10 PE=1 SV=1 241 492 5.0E-10
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 3 84 6.0E-10
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 2 87 9.0E-10
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 1 83 1.0E-09
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 3 77 1.0E-09
sp|Q1BBA3|MBTN_MYCSS Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium sp. (strain MCS) GN=mbtN PE=3 SV=1 152 523 1.0E-09
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 3 98 2.0E-09
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 3 88 2.0E-09
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 2 68 2.0E-09
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 3 56 3.0E-09
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 2 89 4.0E-09
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 3 87 6.0E-09
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 3 88 6.0E-09
sp|Q8K370|ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus GN=Acad10 PE=1 SV=1 241 435 7.0E-09
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 3 89 7.0E-09
sp|B3DMA2|ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus GN=Acad11 PE=1 SV=1 244 521 1.0E-08
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 2 101 1.0E-08
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 1 77 1.0E-08
sp|Q9DBS4|ACOXL_MOUSE Acyl-coenzyme A oxidase-like protein OS=Mus musculus GN=Acoxl PE=1 SV=1 266 529 1.0E-08
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 2 84 1.0E-08
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 1 84 2.0E-08
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 3 84 3.0E-08
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 3 84 3.0E-08
sp|A0PJ29|D4FAD_REBSA Acyl-lipid (7-3)-desaturase OS=Rebecca salina GN=D4Des PE=1 SV=1 2 85 3.0E-08
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 3 56 3.0E-08
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 4 56 4.0E-08
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 3 83 4.0E-08
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 2 62 7.0E-08
sp|Q80XL6|ACD11_MOUSE Acyl-CoA dehydrogenase family member 11 OS=Mus musculus GN=Acad11 PE=1 SV=2 244 521 7.0E-08
sp|Q9NUZ1|ACOXL_HUMAN Acyl-coenzyme A oxidase-like protein OS=Homo sapiens GN=ACOXL PE=2 SV=3 211 529 7.0E-08
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 3 88 8.0E-08
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 2 77 1.0E-07
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 2 62 1.0E-07
sp|Q5LLW7|DMDC_RUEPO 3-methylmercaptopropionyl-CoA dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdC PE=1 SV=1 245 530 1.0E-07
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 3 56 1.0E-07
sp|Q709F0|ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens GN=ACAD11 PE=1 SV=2 244 530 1.0E-07
sp|Q5R778|ACD11_PONAB Acyl-CoA dehydrogenase family member 11 OS=Pongo abelii GN=ACAD11 PE=2 SV=2 244 530 1.0E-07
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 3 56 1.0E-07
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 2 77 1.0E-07
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 2 77 1.0E-07
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 2 77 2.0E-07
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 5 113 2.0E-07
sp|Q920L1|FADS1_MOUSE Fatty acid desaturase 1 OS=Mus musculus GN=Fads1 PE=1 SV=1 2 88 2.0E-07
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 2 101 3.0E-07
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 2 77 3.0E-07
sp|Q1ZXQ5|FAD5C_DICDI Probable Delta(5) fatty acid desaturase C OS=Dictyostelium discoideum GN=DDB_G0294553 PE=3 SV=1 1 84 3.0E-07
sp|Q6VPV2|D4FAD_DIALT Acyl-lipid (7-3)-desaturase OS=Diacronema lutheri GN=Plesd1 PE=1 SV=1 7 83 3.0E-07
sp|Q920R3|FADS1_RAT Fatty acid desaturase 1 OS=Rattus norvegicus GN=Fads1 PE=2 SV=1 3 92 4.0E-07
sp|P9WQF9|MBTN_MYCTU Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtN PE=1 SV=1 160 523 4.0E-07
sp|P9WQF8|MBTN_MYCTO Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtN PE=3 SV=1 160 523 4.0E-07
sp|P63432|MBTN_MYCBO Acyl-[acyl-carrier-protein] dehydrogenase MbtN OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtN PE=3 SV=1 160 523 4.0E-07
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 2 79 4.0E-07
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 2 77 5.0E-07
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 2 77 5.0E-07
sp|Q8S3C0|D4FAD_THRSP Acyl-lipid (7-3)-desaturase OS=Thraustochytrium sp. GN=Fad4 PE=1 SV=1 10 77 6.0E-07
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 2 77 7.0E-07
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 3 56 7.0E-07
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 3 56 8.0E-07
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 2 77 8.0E-07
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 2 82 1.0E-06
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 2 104 1.0E-06
sp|A4KDP1|D8FAD_REBSA Acyl-lipid 8-desaturase OS=Rebecca salina GN=D8Des PE=2 SV=1 8 96 2.0E-06
sp|Q60HD0|SUOX_MACFA Sulfite oxidase, mitochondrial OS=Macaca fascicularis GN=SUOX PE=2 SV=3 2 137 2.0E-06
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 5 56 2.0E-06
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 5 113 2.0E-06
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 5 56 2.0E-06
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 6 60 2.0E-06
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 4 77 3.0E-06
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 3 62 4.0E-06
sp|P51687|SUOX_HUMAN Sulfite oxidase, mitochondrial OS=Homo sapiens GN=SUOX PE=1 SV=2 2 137 4.0E-06
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 1 62 6.0E-06
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 3 57 7.0E-06
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 5 98 9.0E-06
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 5 56 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0050662 coenzyme binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2158
MSKVFTASDVASHNKPDNLYIIVDGDVYDLTKFQDDHPGGKKILQRVAGKDASKQFWKYHNEGILKKYQARLQVG
SLDSKPKPKAEPAPAAAPARKAPPKQASSHDDDGAEPLEPFGDQIPFADPAWYQSYHSPYFNETHAALRAEVRQW
VESEIEPNVTEWDEAKRVPEEIYKEMGRRGYLAGLLGIKYPTQYAAGVKSVPPERWDLFHEMLVTDELSRAGSGG
FVWNIIGGFGIGCPPVMKFGSQALRDRIMPGILAGDKRICLAITEPDAGSDVANLTCEARLSDDGKHFIVNGEKK
WITNGIWCDYFTTAVRTGGPGMNGVSLLLIERGEGVSTRRMDCQGVWSSGTTYITFEDVKVPVENLLGKKNQGFR
VIMTNFNHERMGIIIQCLRFSRCCFEESVKYANKRRTFGKKLIDHPVIRMKLAHMARQIEASYNWLENVVYQCQK
MGETEAMLRLGGPIASLKAQATVTFEFCAREASQIFGGLSYSRGGQGGKVERLYRDVRAYAIPGGSEEIMLDLSM
RQSMRVAKAMGMKL*
Coding >Hirsu2|2158
ATGTCCAAGGTCTTCACGGCGAGCGACGTGGCGTCGCATAACAAGCCCGACAACCTGTACATCATCGTCGACGGC
GACGTCTACGACCTGACCAAGTTCCAGGACGACCATCCCGGCGGTAAGAAGATCCTGCAGCGCGTGGCCGGCAAG
GACGCCTCCAAGCAGTTCTGGAAGTATCACAACGAGGGCATCCTCAAGAAGTACCAGGCCCGCCTGCAGGTCGGC
TCGCTCGACTCCAAGCCCAAGCCCAAGGCCGAGCCGGCTCCGGCCGCGGCCCCGGCCCGCAAGGCGCCCCCGAAG
CAGGCCTCGAGCCATGACGACGACGGCGCCGAGCCGCTCGAGCCGTTTGGCGACCAGATCCCCTTCGCCGATCCG
GCTTGGTACCAGAGCTACCACTCGCCCTACTTCAACGAGACGCACGCCGCGCTGCGGGCCGAGGTCCGGCAGTGG
GTGGAGAGCGAGATCGAGCCCAACGTGACGGAGTGGGACGAGGCCAAGCGGGTGCCGGAGGAGATCTACAAGGAG
ATGGGCCGGCGCGGCTACCTGGCCGGCCTGCTGGGCATCAAGTACCCGACGCAGTACGCGGCGGGCGTCAAGTCG
GTGCCGCCGGAGCGCTGGGACCTGTTCCACGAGATGCTGGTGACGGACGAGCTGTCGCGCGCCGGCTCCGGCGGC
TTCGTCTGGAACATCATCGGCGGCTTCGGCATCGGCTGCCCGCCCGTCATGAAGTTCGGCTCGCAGGCGCTGCGC
GACCGCATCATGCCGGGCATCCTCGCCGGCGACAAGCGCATCTGCCTGGCCATCACGGAGCCCGACGCCGGCAGC
GACGTGGCCAACCTGACGTGCGAGGCCCGCCTCAGCGACGACGGCAAGCACTTCATCGTCAACGGCGAGAAGAAG
TGGATCACCAACGGCATCTGGTGCGACTACTTCACCACGGCCGTCCGCACCGGCGGGCCCGGCATGAACGGCGTC
AGCCTGCTGCTCATCGAGCGCGGCGAGGGCGTCAGCACCCGCCGCATGGACTGCCAGGGCGTCTGGTCTTCCGGC
ACCACCTACATCACCTTTGAGGACGTCAAGGTGCCCGTCGAGAACCTGCTGGGCAAGAAGAACCAGGGCTTCCGA
GTCATCATGACCAACTTCAACCACGAGCGCATGGGCATCATCATCCAGTGCCTCCGCTTCTCGCGCTGCTGCTTC
GAGGAGTCGGTCAAGTACGCCAACAAGCGCCGCACCTTTGGCAAGAAGCTCATCGACCACCCCGTCATCCGCATG
AAGCTGGCCCACATGGCGCGCCAGATCGAGGCCTCGTACAACTGGCTCGAGAACGTCGTCTACCAGTGCCAGAAG
ATGGGCGAGACCGAGGCCATGCTGCGGCTCGGCGGGCCCATCGCCAGCCTCAAGGCCCAGGCGACCGTCACCTTT
GAGTTCTGCGCCCGCGAGGCCAGCCAGATCTTCGGCGGCCTGAGCTACTCGCGCGGCGGCCAGGGCGGCAAGGTC
GAGAGGCTGTACCGCGACGTCCGCGCCTACGCCATCCCCGGCGGCAGCGAGGAGATCATGCTGGACCTGAGCATG
CGGCAGAGCATGAGGGTGGCCAAGGCCATGGGCATGAAGCTGTGA
Transcript >Hirsu2|2158
ATGTCCAAGGTCTTCACGGCGAGCGACGTGGCGTCGCATAACAAGCCCGACAACCTGTACATCATCGTCGACGGC
GACGTCTACGACCTGACCAAGTTCCAGGACGACCATCCCGGCGGTAAGAAGATCCTGCAGCGCGTGGCCGGCAAG
GACGCCTCCAAGCAGTTCTGGAAGTATCACAACGAGGGCATCCTCAAGAAGTACCAGGCCCGCCTGCAGGTCGGC
TCGCTCGACTCCAAGCCCAAGCCCAAGGCCGAGCCGGCTCCGGCCGCGGCCCCGGCCCGCAAGGCGCCCCCGAAG
CAGGCCTCGAGCCATGACGACGACGGCGCCGAGCCGCTCGAGCCGTTTGGCGACCAGATCCCCTTCGCCGATCCG
GCTTGGTACCAGAGCTACCACTCGCCCTACTTCAACGAGACGCACGCCGCGCTGCGGGCCGAGGTCCGGCAGTGG
GTGGAGAGCGAGATCGAGCCCAACGTGACGGAGTGGGACGAGGCCAAGCGGGTGCCGGAGGAGATCTACAAGGAG
ATGGGCCGGCGCGGCTACCTGGCCGGCCTGCTGGGCATCAAGTACCCGACGCAGTACGCGGCGGGCGTCAAGTCG
GTGCCGCCGGAGCGCTGGGACCTGTTCCACGAGATGCTGGTGACGGACGAGCTGTCGCGCGCCGGCTCCGGCGGC
TTCGTCTGGAACATCATCGGCGGCTTCGGCATCGGCTGCCCGCCCGTCATGAAGTTCGGCTCGCAGGCGCTGCGC
GACCGCATCATGCCGGGCATCCTCGCCGGCGACAAGCGCATCTGCCTGGCCATCACGGAGCCCGACGCCGGCAGC
GACGTGGCCAACCTGACGTGCGAGGCCCGCCTCAGCGACGACGGCAAGCACTTCATCGTCAACGGCGAGAAGAAG
TGGATCACCAACGGCATCTGGTGCGACTACTTCACCACGGCCGTCCGCACCGGCGGGCCCGGCATGAACGGCGTC
AGCCTGCTGCTCATCGAGCGCGGCGAGGGCGTCAGCACCCGCCGCATGGACTGCCAGGGCGTCTGGTCTTCCGGC
ACCACCTACATCACCTTTGAGGACGTCAAGGTGCCCGTCGAGAACCTGCTGGGCAAGAAGAACCAGGGCTTCCGA
GTCATCATGACCAACTTCAACCACGAGCGCATGGGCATCATCATCCAGTGCCTCCGCTTCTCGCGCTGCTGCTTC
GAGGAGTCGGTCAAGTACGCCAACAAGCGCCGCACCTTTGGCAAGAAGCTCATCGACCACCCCGTCATCCGCATG
AAGCTGGCCCACATGGCGCGCCAGATCGAGGCCTCGTACAACTGGCTCGAGAACGTCGTCTACCAGTGCCAGAAG
ATGGGCGAGACCGAGGCCATGCTGCGGCTCGGCGGGCCCATCGCCAGCCTCAAGGCCCAGGCGACCGTCACCTTT
GAGTTCTGCGCCCGCGAGGCCAGCCAGATCTTCGGCGGCCTGAGCTACTCGCGCGGCGGCCAGGGCGGCAAGGTC
GAGAGGCTGTACCGCGACGTCCGCGCCTACGCCATCCCCGGCGGCAGCGAGGAGATCATGCTGGACCTGAGCATG
CGGCAGAGCATGAGGGTGGCCAAGGCCATGGGCATGAAGCTGTGA
Gene >Hirsu2|2158
ATGTCCAAGGTCTTCACGGCGAGCGACGTGGCGTCGCATAACAAGCCCGACAACCTGTACATCATCGTCGACGGC
GACGTCTACGACCTGACCAAGTTCCAGGACGACCATCCCGGTACGGCCGGCCTCCCCCCCCCCCCCCCCCCTCTC
TCTCCCCCCCCCCCCCCGGCCCGGGTCGGCAGCTGACGGCGGCCGTGTTCCAGGCGGTAAGAAGATCCTGCAGCG
CGTGGCCGGCAAGGACGCCTCCAAGCAGTTCTGGAAGTATCACAACGAGGGCATCCTCAAGAAGTACCAGGCCCG
CCTGCAGGTCGGCTCGCTCGACTCCAAGCCCAAGCCCAAGGCCGAGCCGGCTCCGGCCGCGGCCCCGGCCCGCAA
GGCGCCCCCGAAGCAGGCCTCGAGCCATGACGACGACGGCGCCGAGCCGCTCGAGCCGTTTGGCGACCAGATCCC
CTTCGCCGATCCGGCTTGGTACCAGAGCGTGAGTGGAGAGCGTCCCGGCAGATTCTTCCTCTCTGCCGCCACCCC
CGTCTCGACTGCGGGGAGACTGGTACGAGGGGATGGTTTTTCTTTTGGCTGACCGTGCTTCCCGTCCAGTACCAC
TCGCCCTACTTCAACGAGACGCACGCCGCGCTGCGGGCCGAGGTCCGGCAGTGGGTGGAGAGCGAGATCGAGCCC
AACGTGACGGAGTGGGACGAGGCCAAGCGGGTGCCGGAGGAGATCTACAAGGAGATGGGCCGGCGCGGCTACCTG
GCCGGCCTGCTGGGCATCAAGTACCCGACGCAGTACGCGGCGGGCGTCAAGTCGGTGCCGCCGGAGCGCTGGGAC
CTGTTCCACGAGATGCTGGTGACGGACGAGCTGTCGCGCGCCGGCTCCGGCGGCTTCGTCTGGAACATCATCGGC
GGCTTCGGCATCGGCTGCCCGCCCGTCATGAAGTTCGGCTCGCAGGCGCTGCGCGACCGCATCATGCCGGGCATC
CTCGCCGGCGACAAGCGCATCTGCCTGGCCATCACGGAGCCCGACGCCGGCAGCGACGTGGCCAACCTGACGTGC
GAGGCCCGCCTCAGCGACGACGGCAAGCACTTCATCGTCAACGGCGAGAAGAAGTGGATCACCAACGGCATCTGG
TGCGACTACTTCACCACGGCCGTCCGCACCGGCGGGCCCGGCATGAACGGCGTCAGCCTGCTGCTCATCGAGCGC
GGCGAGGGCGTCAGCACCCGCCGCATGGACTGCCAGGGCGTCTGGTCTTCCGGCACCACCTACATCACCTTTGAG
GACGTCAAGGTGCCCGTCGAGAACCTGCTGGGCAAGAAGAACCAGGGCTTCCGAGGTACGAAATGCCGTTCTCTC
TCTCTCTCTCTCTTCTCTCCCCCCCCCCTCTCTCTGTCTCTCTCTCTCTGTCTATCTCTCTCTTCCTCTCCCCTT
CCCACGGAAAGTCTGTGGATGACGAGACGGATGGATCGAGGACTGACCCGAAACCAGTCATCATGACCAACTTCA
ACCACGAGCGCATGGGCATCATCATCCAGTGCCTCCGCTTCTCGCGCTGCTGCTTCGAGGAGTCGGTCAAGTACG
CCAACAAGCGCCGCACCTTTGGCAAGAAGCTCATCGACCACCCCGTCATCCGCATGAAGCTGGCCCACATGGCGC
GCCAGATCGAGGCCTCGTACAACTGGCTCGAGAACGTCGTCTACCAGTGCCAGAAGATGGGCGAGACCGAGGCCA
TGCTGCGGCTCGGCGGGCCCATCGCCAGCCTCAAGGCCCAGGCGACCGTCACCTTTGAGTTCTGCGCCCGCGAGG
CCAGCCAGATCTTCGGCGGCCTGAGCTACTCGCGCGGCGGCCAGGGCGGCAAGGTCGAGAGGCTGTACCGCGACG
TCCGCGCCTACGCCATCCCCGGCGGCAGCGAGGAGATCATGCTGGACCTGAGCATGCGGCAGAGCATGAGGGTGG
CCAAGGCCATGGGCATGAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail