Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2144
Gene name
LocationContig_15:40412..41230
Strand+
Gene length (bp)818
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole|Golgi apparatus Signal peptide|Transmembrane domain 0.1992 0.1798 0.1926 0.2037 0.0472 0.0026 0.4057 0.5924 0.7514 0.0148

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 70 92 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6551
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3019
Ophiocordyceps australis map64 (Brazil) OphauB2|5796
Ophiocordyceps subramaniannii Hirsu2|2144 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2144
MSFLYAKPKDASDHTSPRSSIDAGEANNSAEFQQETKAFLAPPERGEDVDQEEAIDPGHRSKIFRCVLQVIILLL
SLGLLFAGYDLYRAITASRASASLESSDQPRPCGDDPLTARSKGCLFDPIAMAWLPNECHDFELTKEFLEMEHWQ
FWAQPVDGQAFSLANVYQGLHSALFVRESYLRHRCVFAWRKIHRAIINTTAIDGYATDWDGIRKCEELFKGSEGD
DKVLHKVNVGYPTCTAQRPVAERQI*
Coding >Hirsu2|2144
ATGTCCTTCCTCTATGCAAAGCCGAAGGATGCCAGCGACCATACAAGCCCAAGGTCTAGCATCGATGCTGGCGAG
GCCAATAACTCGGCGGAGTTCCAGCAGGAAACCAAGGCTTTCCTGGCGCCTCCTGAGCGAGGCGAAGACGTTGAC
CAGGAGGAGGCCATAGACCCGGGCCATCGATCGAAGATCTTCCGCTGTGTGCTACAAGTCATCATTTTGCTTCTC
AGTCTGGGCCTTTTATTCGCAGGGTACGACTTGTATCGCGCCATCACGGCATCTCGAGCATCGGCTTCCCTTGAA
AGCAGCGACCAGCCTCGGCCTTGCGGAGACGATCCACTCACAGCTCGATCCAAGGGCTGCTTATTTGATCCTATT
GCGATGGCATGGCTGCCGAACGAATGCCACGACTTTGAACTGACCAAAGAGTTCCTCGAGATGGAGCACTGGCAA
TTCTGGGCACAGCCTGTCGACGGCCAGGCTTTTTCCCTGGCGAATGTCTACCAAGGCCTTCACTCGGCCCTCTTC
GTCCGCGAATCTTACCTGCGCCATCGTTGCGTCTTCGCCTGGAGAAAGATTCACCGTGCCATCATCAATACGACG
GCAATAGACGGATATGCGACTGACTGGGATGGAATCCGGAAATGCGAGGAGCTTTTCAAGGGCAGTGAGGGCGAT
GACAAGGTGTTGCACAAGGTCAATGTGGGCTATCCGACTTGCACCGCGCAGCGGCCAGTCGCTGAACGTCAGATT
TGA
Transcript >Hirsu2|2144
ATGTCCTTCCTCTATGCAAAGCCGAAGGATGCCAGCGACCATACAAGCCCAAGGTCTAGCATCGATGCTGGCGAG
GCCAATAACTCGGCGGAGTTCCAGCAGGAAACCAAGGCTTTCCTGGCGCCTCCTGAGCGAGGCGAAGACGTTGAC
CAGGAGGAGGCCATAGACCCGGGCCATCGATCGAAGATCTTCCGCTGTGTGCTACAAGTCATCATTTTGCTTCTC
AGTCTGGGCCTTTTATTCGCAGGGTACGACTTGTATCGCGCCATCACGGCATCTCGAGCATCGGCTTCCCTTGAA
AGCAGCGACCAGCCTCGGCCTTGCGGAGACGATCCACTCACAGCTCGATCCAAGGGCTGCTTATTTGATCCTATT
GCGATGGCATGGCTGCCGAACGAATGCCACGACTTTGAACTGACCAAAGAGTTCCTCGAGATGGAGCACTGGCAA
TTCTGGGCACAGCCTGTCGACGGCCAGGCTTTTTCCCTGGCGAATGTCTACCAAGGCCTTCACTCGGCCCTCTTC
GTCCGCGAATCTTACCTGCGCCATCGTTGCGTCTTCGCCTGGAGAAAGATTCACCGTGCCATCATCAATACGACG
GCAATAGACGGATATGCGACTGACTGGGATGGAATCCGGAAATGCGAGGAGCTTTTCAAGGGCAGTGAGGGCGAT
GACAAGGTGTTGCACAAGGTCAATGTGGGCTATCCGACTTGCACCGCGCAGCGGCCAGTCGCTGAACGTCAGATT
TGA
Gene >Hirsu2|2144
ATGTCCTTCCTCTATGGTGAGGTTGTTTCCAAGACCCAAGCAACGTCTGTCGCTAATTTTTGCTCTTTGCCGCCG
AGACAGCAAAGCCGAAGGATGCCAGCGACCATACAAGCCCAAGGTCTAGCATCGATGCTGGCGAGGCCAATAACT
CGGCGGAGTTCCAGCAGGAAACCAAGGCTTTCCTGGCGCCTCCTGAGCGAGGCGAAGACGTTGACCAGGAGGAGG
CCATAGACCCGGGCCATCGATCGAAGATCTTCCGCTGTGTGCTACAAGTCATCATTTTGCTTCTCAGTCTGGGCC
TTTTATTCGCAGGGTACGACTTGTATCGCGCCATCACGGCATCTCGAGCATCGGCTTCCCTTGAAAGCAGCGACC
AGCCTCGGCCTTGCGGAGACGATCCACTCACAGCTCGATCCAAGGGCTGCTTATTTGATCCTATTGCGATGGCAT
GGCTGCCGAACGAATGCCACGACTTTGAACTGACCAAAGAGTTCCTCGAGATGGAGCACTGGCAATTCTGGGCAC
AGCCTGTCGACGGCCAGGCTTTTTCCCTGGCGAATGTCTACCAAGGCCTTCACTCGGCCCTCTTCGTCCGCGAAT
CTTACCTGCGCCATCGTTGCGTCTTCGCCTGGAGAAAGATTCACCGTGCCATCATCAATACGACGGCAATAGACG
GATATGCGACTGACTGGGATGGAATCCGGAAATGCGAGGAGCTTTTCAAGGGCAGTGAGGGCGATGACAAGGTGT
TGCACAAGGTCAATGTGGGCTATCCGACTTGCACCGCGCAGCGGCCAGTCGCTGAACGTCAGATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail