Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2139
Gene name
LocationContig_15:23513..25177
Strand+
Gene length (bp)1664
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00491 Arginase Arginase family 3.3E-81 93 378

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10088|SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.09 PE=3 SV=1 62 386 1.0E-95
sp|Q9C0Y9|SPEB3_SCHPO Putative agmatinase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.03 PE=3 SV=2 49 386 3.0E-88
sp|O42887|SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.03 PE=3 SV=1 47 386 9.0E-81
sp|Q6CIB4|GBU1_KLULA Guanidinobutyrase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GBU1 PE=1 SV=1 60 383 1.0E-72
sp|Q8KZT5|GBH_ARTS8 Guanidinobutyrase OS=Arthrobacter sp. (strain KUJ 8602) GN=gbh PE=1 SV=1 62 382 5.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10088|SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.09 PE=3 SV=1 62 386 1.0E-95
sp|Q9C0Y9|SPEB3_SCHPO Putative agmatinase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.03 PE=3 SV=2 49 386 3.0E-88
sp|O42887|SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.03 PE=3 SV=1 47 386 9.0E-81
sp|Q6CIB4|GBU1_KLULA Guanidinobutyrase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GBU1 PE=1 SV=1 60 383 1.0E-72
sp|Q8KZT5|GBH_ARTS8 Guanidinobutyrase OS=Arthrobacter sp. (strain KUJ 8602) GN=gbh PE=1 SV=1 62 382 5.0E-60
sp|A1KVF9|SPEB_NEIMF Agmatinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=speB PE=3 SV=1 90 385 3.0E-51
sp|A9M254|SPEB_NEIM0 Agmatinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=speB PE=3 SV=1 90 385 3.0E-51
sp|P60654|SPEB_NEIMB Agmatinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=speB PE=3 SV=1 90 385 1.0E-50
sp|P60653|SPEB_NEIMA Agmatinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=speB PE=3 SV=1 90 385 1.0E-50
sp|B4RP98|SPEB_NEIG2 Agmatinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=speB PE=3 SV=1 90 385 3.0E-50
sp|Q5F6R3|SPEB_NEIG1 Agmatinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=speB PE=3 SV=1 90 385 3.0E-50
sp|Q9I3S3|GBUA_PSEAE Guanidinobutyrase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gbuA PE=1 SV=1 93 371 2.0E-49
sp|P0DJQ3|PAH_STRCL Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus GN=pah PE=1 SV=1 92 379 4.0E-49
sp|P0DJQ4|PAH_STRC2 Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pah PE=3 SV=1 92 379 4.0E-49
sp|Q7X3P1|SPEB_PROMI Agmatinase OS=Proteus mirabilis GN=speB PE=3 SV=2 89 385 8.0E-47
sp|B4F1A3|SPEB_PROMH Agmatinase OS=Proteus mirabilis (strain HI4320) GN=speB PE=3 SV=1 89 385 8.0E-47
sp|A8GIX7|SPEB_SERP5 Agmatinase OS=Serratia proteamaculans (strain 568) GN=speB PE=3 SV=1 96 385 1.0E-45
sp|B7NI01|SPEB_ECO7I Agmatinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=speB PE=3 SV=1 90 364 3.0E-45
sp|Q7N122|SPEB_PHOLL Agmatinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=speB PE=3 SV=1 89 385 3.0E-45
sp|A8A477|SPEB_ECOHS Agmatinase OS=Escherichia coli O9:H4 (strain HS) GN=speB PE=3 SV=1 90 364 3.0E-45
sp|A8APF8|SPEB_CITK8 Agmatinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=speB PE=3 SV=1 90 364 4.0E-45
sp|A4WE75|SPEB_ENT38 Agmatinase OS=Enterobacter sp. (strain 638) GN=speB PE=3 SV=1 90 364 5.0E-45
sp|Q7VRG4|SPEB_BLOFL Agmatinase OS=Blochmannia floridanus GN=speB PE=3 SV=1 93 379 1.0E-44
sp|B2U0V8|SPEB_SHIB3 Agmatinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|Q3YXT4|SPEB_SHISS Agmatinase OS=Shigella sonnei (strain Ss046) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|A7MJQ1|SPEB_CROS8 Agmatinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=speB PE=3 SV=1 96 363 2.0E-44
sp|Q32C02|SPEB_SHIDS Agmatinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|P60656|SPEB_SALTY Agmatinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|P60655|SPEB_SALTI Agmatinase OS=Salmonella typhi GN=speB PE=3 SV=1 90 364 2.0E-44
sp|B4TV53|SPEB_SALSV Agmatinase OS=Salmonella schwarzengrund (strain CVM19633) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|B5BFP3|SPEB_SALPK Agmatinase OS=Salmonella paratyphi A (strain AKU_12601) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|C0PY54|SPEB_SALPC Agmatinase OS=Salmonella paratyphi C (strain RKS4594) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|A9N3R6|SPEB_SALPB Agmatinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|Q5PJH7|SPEB_SALPA Agmatinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|B4T5I5|SPEB_SALNS Agmatinase OS=Salmonella newport (strain SL254) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|B4THG3|SPEB_SALHS Agmatinase OS=Salmonella heidelberg (strain SL476) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|Q57K36|SPEB_SALCH Agmatinase OS=Salmonella choleraesuis (strain SC-B67) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|B5F5K3|SPEB_SALA4 Agmatinase OS=Salmonella agona (strain SL483) GN=speB PE=3 SV=1 90 364 2.0E-44
sp|A6TDU9|SPEB_KLEP7 Agmatinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=speB PE=3 SV=1 89 364 3.0E-44
sp|B5XUB2|SPEB_KLEP3 Agmatinase OS=Klebsiella pneumoniae (strain 342) GN=speB PE=3 SV=1 89 364 3.0E-44
sp|P60657|SPEB_SHIFL Agmatinase OS=Shigella flexneri GN=speB PE=3 SV=1 90 364 3.0E-44
sp|Q0T0V7|SPEB_SHIF8 Agmatinase OS=Shigella flexneri serotype 5b (strain 8401) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|Q31WK0|SPEB_SHIBS Agmatinase OS=Shigella boydii serotype 4 (strain Sb227) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B7LPE7|SPEB_ESCF3 Agmatinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B1LDE6|SPEB_ECOSM Agmatinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B7N7I9|SPEB_ECOLU Agmatinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|P60651|SPEB_ECOLI Agmatinase OS=Escherichia coli (strain K12) GN=speB PE=1 SV=1 90 364 3.0E-44
sp|B1IT67|SPEB_ECOLC Agmatinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B1XF99|SPEB_ECODH Agmatinase OS=Escherichia coli (strain K12 / DH10B) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|C5A0K6|SPEB_ECOBW Agmatinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B7LYW6|SPEB_ECO8A Agmatinase OS=Escherichia coli O8 (strain IAI1) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B5YQD4|SPEB_ECO5E Agmatinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|P60652|SPEB_ECO57 Agmatinase OS=Escherichia coli O157:H7 GN=speB PE=3 SV=1 90 364 3.0E-44
sp|A7ZR59|SPEB_ECO24 Agmatinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B5RE39|SPEB_SALG2 Agmatinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B5QXK5|SPEB_SALEP Agmatinase OS=Salmonella enteritidis PT4 (strain P125109) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|B5FUJ0|SPEB_SALDC Agmatinase OS=Salmonella dublin (strain CT_02021853) GN=speB PE=3 SV=1 90 364 3.0E-44
sp|Q1R791|SPEB_ECOUT Agmatinase OS=Escherichia coli (strain UTI89 / UPEC) GN=speB PE=3 SV=1 90 364 4.0E-44
sp|Q8FE36|SPEB_ECOL6 Agmatinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=speB PE=3 SV=1 90 364 4.0E-44
sp|Q0TDR4|SPEB_ECOL5 Agmatinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=speB PE=3 SV=1 90 364 4.0E-44
sp|A1AFC5|SPEB_ECOK1 Agmatinase OS=Escherichia coli O1:K1 / APEC GN=speB PE=3 SV=1 90 364 4.0E-44
sp|B7MZN5|SPEB_ECO81 Agmatinase OS=Escherichia coli O81 (strain ED1a) GN=speB PE=3 SV=1 90 364 4.0E-44
sp|B7MMC5|SPEB_ECO45 Agmatinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=speB PE=3 SV=1 90 364 4.0E-44
sp|B7UHY3|SPEB_ECO27 Agmatinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=speB PE=3 SV=1 90 364 4.0E-44
sp|C5BAV1|SPEB_EDWI9 Agmatinase OS=Edwardsiella ictaluri (strain 93-146) GN=speB PE=3 SV=1 93 364 4.0E-44
sp|B6I775|SPEB_ECOSE Agmatinase OS=Escherichia coli (strain SE11) GN=speB PE=3 SV=1 90 364 8.0E-44
sp|B7LFJ6|SPEB_ECO55 Agmatinase OS=Escherichia coli (strain 55989 / EAEC) GN=speB PE=3 SV=1 90 364 8.0E-44
sp|Q90XD2|SPEB_CHICK Agmatinase, mitochondrial OS=Gallus gallus GN=AGMAT PE=2 SV=1 86 382 1.0E-43
sp|Q2NRD3|SPEB_SODGM Agmatinase OS=Sodalis glossinidius (strain morsitans) GN=speB PE=3 SV=1 86 379 3.0E-42
sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2 86 379 3.0E-42
sp|Q7P0S6|SPEB_CHRVO Agmatinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=speB PE=3 SV=1 93 364 4.0E-42
sp|Q9I6K2|GPUA_PSEAE Guanidinopropionase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gpuA PE=1 SV=1 94 390 1.0E-41
sp|Q0D2L3|SPEB_RAT Agmatinase, mitochondrial OS=Rattus norvegicus GN=Agmat PE=2 SV=1 86 379 3.0E-38
sp|A2AS89|SPEB_MOUSE Agmatinase, mitochondrial OS=Mus musculus GN=Agmat PE=1 SV=1 86 379 9.0E-38
sp|P73270|SPEB2_SYNY3 Probable agmatinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB2 PE=3 SV=1 60 394 8.0E-28
sp|Q57757|Y309_METJA Uncharacterized protein MJ0309 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0309 PE=3 SV=1 58 383 1.0E-27
sp|Q9K6B9|SPEB_BACHD Agmatinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=speB PE=3 SV=2 87 379 3.0E-26
sp|P70999|SPEB_BACSU Agmatinase OS=Bacillus subtilis (strain 168) GN=speB PE=1 SV=1 93 379 3.0E-25
sp|P46637|ARGI1_ARATH Arginase 1, mitochondrial OS=Arabidopsis thaliana GN=ARGAH1 PE=2 SV=1 95 378 5.0E-25
sp|Q81JT1|SPEB_BACAN Agmatinase OS=Bacillus anthracis GN=speB PE=3 SV=1 88 379 5.0E-25
sp|Q814Q2|SPEB_BACCR Agmatinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=speB PE=3 SV=1 94 379 9.0E-25
sp|B8AU84|ARGI1_ORYSI Arginase 1, mitochondrial OS=Oryza sativa subsp. indica GN=B0616E02-H0507E05.7 PE=1 SV=1 96 378 2.0E-24
sp|Q7X7N2|ARGI1_ORYSJ Arginase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=ARG1 PE=2 SV=1 96 378 2.0E-24
sp|Q9ZPF5|ARGI2_ARATH Arginase 2, mitochondrial OS=Arabidopsis thaliana GN=ARGAH2 PE=2 SV=1 95 378 1.0E-22
sp|P19268|YHMF_METFE Uncharacterized 32.2 kDa protein in hmfB 3'region OS=Methanothermus fervidus PE=3 SV=1 89 379 2.0E-22
sp|O49046|ARGI_SOYBN Arginase OS=Glycine max GN=AG1 PE=2 SV=1 96 378 3.0E-18
sp|Q5JI38|SPEBH_THEKO N(1)-aminopropylagmatine ureohydrolase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0882 PE=1 SV=1 96 376 3.0E-18
sp|Q5SJ85|SEPBH_THET8 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1129 PE=1 SV=1 85 368 3.0E-17
sp|Q9KBE3|HUTG_BACHD Formimidoylglutamase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hutG PE=3 SV=1 94 379 4.0E-17
sp|P60088|ARGI_STAAN Arginase OS=Staphylococcus aureus (strain N315) GN=arg PE=1 SV=1 94 366 4.0E-17
sp|P60087|ARGI_STAAM Arginase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arg PE=3 SV=1 94 366 4.0E-17
sp|P60086|ARGI_STAAC Arginase OS=Staphylococcus aureus (strain COL) GN=arg PE=3 SV=1 94 366 4.0E-17
sp|Q8NVE3|ARGI_STAAW Arginase OS=Staphylococcus aureus (strain MW2) GN=arg PE=3 SV=1 94 366 6.0E-17
sp|Q6G7E9|ARGI_STAAS Arginase OS=Staphylococcus aureus (strain MSSA476) GN=arg PE=3 SV=1 94 366 6.0E-17
sp|P42068|HUTG_BACSU Formimidoylglutamase OS=Bacillus subtilis (strain 168) GN=hutG PE=1 SV=1 95 386 6.0E-17
sp|Q72JK8|SPEBH_THET2 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0764 PE=1 SV=1 85 368 1.0E-16
sp|Q6GER3|ARGI_STAAR Arginase OS=Staphylococcus aureus (strain MRSA252) GN=arg PE=3 SV=1 89 366 1.0E-15
sp|P39138|ARGI_BACSU Arginase OS=Bacillus subtilis (strain 168) GN=rocF PE=1 SV=1 94 379 1.0E-13
sp|Q95KM0|ARGI1_RABIT Arginase-1 OS=Oryctolagus cuniculus GN=ARG1 PE=2 SV=2 88 389 7.0E-13
sp|P53608|ARGI_BACCD Arginase OS=Bacillus caldovelox GN=rocF PE=1 SV=1 94 369 1.0E-12
sp|P40906|ARGI_COCP7 Arginase OS=Coccidioides posadasii (strain C735) GN=ARG PE=3 SV=2 187 372 2.0E-11
sp|P49900|ARGI_LITCT Arginase, hepatic OS=Lithobates catesbeiana PE=2 SV=1 87 379 3.0E-11
sp|Q91554|ARGN2_XENLA Arginase, non-hepatic 2 OS=Xenopus laevis GN=arg2-b PE=2 SV=1 85 375 3.0E-11
sp|P05089|ARGI1_HUMAN Arginase-1 OS=Homo sapiens GN=ARG1 PE=1 SV=2 87 389 3.0E-11
sp|O08701|ARGI2_RAT Arginase-2, mitochondrial OS=Rattus norvegicus GN=Arg2 PE=2 SV=1 88 375 4.0E-11
sp|Q1E180|ARGI_COCIM Arginase OS=Coccidioides immitis (strain RS) GN=ARG PE=3 SV=1 187 372 4.0E-11
sp|Q91553|ARGN1_XENLA Arginase, non-hepatic 1 OS=Xenopus laevis GN=arg2-a PE=2 SV=1 85 375 5.0E-11
sp|Q91555|ARGN3_XENLA Arginase, non-hepatic 3 OS=Xenopus laevis GN=arg2-c PE=2 SV=1 85 375 5.0E-11
sp|P33280|ARGI_NEUCR Arginase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aga-1 PE=1 SV=3 187 358 2.0E-10
sp|P07824|ARGI1_RAT Arginase-1 OS=Rattus norvegicus GN=Arg1 PE=1 SV=2 88 389 2.0E-10
sp|Q12611|ARGI_EMENI Arginase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agaA PE=3 SV=2 188 372 3.0E-10
sp|Q7M0Z3|ARGI_BREBE Arginase OS=Brevibacillus brevis GN=rocF PE=1 SV=1 93 366 4.0E-10
sp|Q74ZW4|ARGI_ASHGO Arginase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CAR1 PE=3 SV=1 168 358 4.0E-10
sp|O08691|ARGI2_MOUSE Arginase-2, mitochondrial OS=Mus musculus GN=Arg2 PE=1 SV=1 88 371 9.0E-10
sp|P78540|ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens GN=ARG2 PE=1 SV=1 90 377 1.0E-09
sp|P14012|ARGI_AGRFC Arginase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=arcA PE=2 SV=1 96 369 2.0E-09
sp|Q61176|ARGI1_MOUSE Arginase-1 OS=Mus musculus GN=Arg1 PE=1 SV=1 88 389 2.0E-09
sp|Q9HQD7|HUTG_HALSA Probable formimidoylglutamase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hutG PE=3 SV=1 87 366 2.0E-09
sp|B0R542|HUTG_HALS3 Formimidoylglutamase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hutG PE=3 SV=1 87 366 2.0E-09
sp|P72703|SPEB1_SYNY3 Agmatinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB1 PE=3 SV=1 187 362 2.0E-09
sp|Q58DL1|ARGI2_BOVIN Arginase-2, mitochondrial OS=Bos taurus GN=ARG2 PE=2 SV=1 88 377 3.0E-09
sp|Q4VK78|ARGI2_RABIT Arginase-2, mitochondrial OS=Oryctolagus cuniculus GN=ARG2 PE=2 SV=1 90 377 3.0E-09
sp|P0A2Y0|ARGI_BRUSU Arginase OS=Brucella suis biovar 1 (strain 1330) GN=arcB PE=3 SV=1 96 379 9.0E-09
sp|P0A2X9|ARGI_BRUME Arginase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=arcB PE=3 SV=1 96 379 9.0E-09
sp|P0A2Y1|ARGI_BRUAB Arginase OS=Brucella abortus biovar 1 (strain 9-941) GN=arcB PE=3 SV=1 96 379 9.0E-09
sp|Q6CLS8|ARGI_KLULA Arginase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR1 PE=1 SV=1 188 363 2.0E-08
sp|P37818|ARGI1_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car1 PE=3 SV=1 89 379 1.0E-07
sp|Q10066|ARGI2_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aru1 PE=3 SV=1 187 379 2.0E-07
sp|P00812|ARGI_YEAST Arginase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR1 PE=1 SV=1 188 358 3.0E-07
sp|Q8FQ76|HUTG_COREF Formimidoylglutamase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hutG PE=3 SV=1 188 371 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2139
MLDRSFLCLLVLWLCWCAPAIAGYGAVDEDSGGQRRLMPPPATAAVRDEFDAMRKGMQTFNTFARLPYMNCFAKE
VEGTTDEDGKNSSSSRYDIAILGAPHDISATVRPGARFGPTDIRSASLIKSIGYSVFTGRHPFRDWAKVVDCGNV
RMSPLDKLVALRTLDRAHEAVTGRPAAHPDRSAVPRVLMLGGDHSTTLSALRSVHQRWGKVSVVHFDSHIDTWDT
EEAVSEYAKLDHGTFLYFAHEEGLILDSSIHVGIRAPYYSHRDVPNDRRCGFETVTARDIDAVGIRGVVDKIRRR
VGNSSVYVTVDIDVLDPAFAPATGTPEPGGWSTRELLSVLHGLEGLHVVGSDVVEVAPAYDSNSQTTALTAGEVV
MSLLDLMVASPAGNASLPAL*
Coding >Hirsu2|2139
ATGCTCGACCGCTCCTTTCTGTGCCTGCTGGTGCTGTGGCTTTGTTGGTGCGCTCCTGCGATCGCGGGTTATGGC
GCCGTCGACGAGGACAGCGGCGGTCAACGGCGCCTCATGCCGCCGCCCGCGACGGCTGCCGTTCGCGACGAGTTT
GATGCTATGCGGAAGGGCATGCAAACGTTCAACACCTTTGCTCGTCTACCGTACATGAATTGCTTCGCGAAAGAG
GTCGAGGGAACGACGGACGAGGACGGCAAGAACAGCAGCAGCAGCAGATATGACATTGCCATCCTCGGCGCGCCC
CACGATATTAGCGCCACTGTCCGGCCTGGAGCACGATTTGGCCCGACGGACATCCGATCCGCCAGTCTGATCAAA
TCCATCGGCTACAGCGTCTTCACCGGGCGTCATCCCTTCCGGGACTGGGCCAAGGTTGTCGACTGCGGCAACGTC
CGCATGTCGCCGCTGGACAAGCTCGTCGCGCTCCGGACGCTCGACCGGGCGCACGAGGCGGTGACGGGGCGGCCG
GCCGCGCACCCCGACCGCTCCGCCGTGCCCCGGGTCTTGATGCTGGGCGGCGACCACAGCACGACGCTCTCGGCT
CTGCGCTCCGTCCACCAGCGGTGGGGGAAGGTGTCTGTCGTCCACTTCGACAGCCACATTGACACATGGGACACG
GAAGAGGCTGTATCCGAATACGCAAAACTAGATCACGGCACGTTTCTCTACTTTGCCCACGAGGAAGGCCTCATC
CTTGATTCCTCGATCCACGTCGGCATCCGCGCACCGTACTACTCCCACCGCGACGTACCGAACGATCGACGGTGC
GGTTTCGAAACGGTCACGGCGCGCGACATCGACGCCGTAGGCATTCGCGGCGTTGTCGACAAGATCCGCCGCCGC
GTTGGCAACAGCAGCGTTTATGTCACCGTCGACATCGACGTCCTGGACCCAGCCTTTGCCCCCGCGACCGGCACT
CCGGAGCCGGGCGGCTGGAGCACGCGTGAGCTCCTCTCGGTCCTGCACGGCCTCGAGGGCCTCCACGTCGTCGGC
AGCGACGTCGTCGAGGTCGCGCCCGCCTACGACTCGAACAGCCAGACGACGGCCCTGACGGCCGGCGAGGTCGTC
ATGTCCCTGCTGGACCTCATGGTCGCGTCGCCCGCCGGCAACGCCTCCTTGCCCGCTCTCTAG
Transcript >Hirsu2|2139
ATGCTCGACCGCTCCTTTCTGTGCCTGCTGGTGCTGTGGCTTTGTTGGTGCGCTCCTGCGATCGCGGGTTATGGC
GCCGTCGACGAGGACAGCGGCGGTCAACGGCGCCTCATGCCGCCGCCCGCGACGGCTGCCGTTCGCGACGAGTTT
GATGCTATGCGGAAGGGCATGCAAACGTTCAACACCTTTGCTCGTCTACCGTACATGAATTGCTTCGCGAAAGAG
GTCGAGGGAACGACGGACGAGGACGGCAAGAACAGCAGCAGCAGCAGATATGACATTGCCATCCTCGGCGCGCCC
CACGATATTAGCGCCACTGTCCGGCCTGGAGCACGATTTGGCCCGACGGACATCCGATCCGCCAGTCTGATCAAA
TCCATCGGCTACAGCGTCTTCACCGGGCGTCATCCCTTCCGGGACTGGGCCAAGGTTGTCGACTGCGGCAACGTC
CGCATGTCGCCGCTGGACAAGCTCGTCGCGCTCCGGACGCTCGACCGGGCGCACGAGGCGGTGACGGGGCGGCCG
GCCGCGCACCCCGACCGCTCCGCCGTGCCCCGGGTCTTGATGCTGGGCGGCGACCACAGCACGACGCTCTCGGCT
CTGCGCTCCGTCCACCAGCGGTGGGGGAAGGTGTCTGTCGTCCACTTCGACAGCCACATTGACACATGGGACACG
GAAGAGGCTGTATCCGAATACGCAAAACTAGATCACGGCACGTTTCTCTACTTTGCCCACGAGGAAGGCCTCATC
CTTGATTCCTCGATCCACGTCGGCATCCGCGCACCGTACTACTCCCACCGCGACGTACCGAACGATCGACGGTGC
GGTTTCGAAACGGTCACGGCGCGCGACATCGACGCCGTAGGCATTCGCGGCGTTGTCGACAAGATCCGCCGCCGC
GTTGGCAACAGCAGCGTTTATGTCACCGTCGACATCGACGTCCTGGACCCAGCCTTTGCCCCCGCGACCGGCACT
CCGGAGCCGGGCGGCTGGAGCACGCGTGAGCTCCTCTCGGTCCTGCACGGCCTCGAGGGCCTCCACGTCGTCGGC
AGCGACGTCGTCGAGGTCGCGCCCGCCTACGACTCGAACAGCCAGACGACGGCCCTGACGGCCGGCGAGGTCGTC
ATGTCCCTGCTGGACCTCATGGTCGCGTCGCCCGCCGGCAACGCCTCCTTGCCCGCTCTCTAG
Gene >Hirsu2|2139
ATGCTCGACCGCTCCTTTCTGTGCCTGCTGGTGCTGTGGCTTTGTTGGTGCGCTCCTGCGATCGCGGGTTATGGC
GCCGTCGACGAGGACAGCGGCGGTCAACGGCGCCTCATGCCGCCGCCCGCGACGGCTGCCGTTCGCGACGAGTTT
GATGCTATGCGGAAGGGCATGCAAACGTTCAACACCTTTGCTCGTCTACCGTACATGAATTGCTTCGCGAAAGAG
GTCGAGGGAACGACGGACGAGGACGGCAAGAACAGCAGCAGCAGCAGATATGACATTGCCATCCTCGGCGCGCCC
CACGATATTGTCAGTTGGAAACCCAGCTCAGCTCCGATCCTGCTCACTTACACTTTGCCATGCAACGCGGCGTCG
ACTGCGTCTAGAGCGCCACTGTCCGGCCTGGAGCACGATTTGGCCCGACGGACATCCGATCCGCCAGTCTGATCA
AATCCATCGGCTACAGCGTCTTCACCGGTTCGTCCGAACCCAGCCGGATCCTGCGCCGTCCTTGTGTTCTGCCCG
TCCATGCTGATCCGTCGCCCAAAAGGGCGTCATCCCTTCCGGGACTGGGCCAAGGTTGTCGACTGCGGCAACGTC
CGCATGTCGCCGCTGGACAAGCTCGTCGCGCTCCGGACGCTCGACCGGGCGCACGAGGCGGTGACGGGGCGGCCG
GCCGCGCACCCCGACCGCTCCGCCGTGCCCCGGGTCTTGATGCTGGGCGGCGACCACAGCACGACGCTCTCGGCT
CTGCGCTCCGTCCACCAGCGGTGGGGGAAGGTGTCTGTCGTCCACTTCGACAGCCACATTGGTGCGTCGCCGACT
GCTTGTTTGGTCGGCCGATGACTGTTCTCACCGATTTGCCAGACACATGGGACACGGAAGAGGCTGTATCCGAAT
ACGCGTAAGTCCCCCTCAAGGCCAGGCACGCGATCCAGTCTGCCCAACTGACACAACGCGCGTGCCTCAGAAAAC
TAGATCACGGCACGTTTCTCTACTTTGCCCACGAGGAAGTATGACGCCAATCCCCCCCCCCTTCCCCCTTCTCCC
CCTCCAAGTGCCGGCATCTGCCGCGCCGCACGACGCCTTCGATGAACTATGGCTGAACCGCACCGGCTCCTGAAC
GCCGCAGGGCCTCATCCTTGATTCCTCGATCCACGTCGGCATCCGCGCACCGTACTACTCCCACCGCGACGTACC
GAACGATCGACGGTGCGGTTTCGAAACGGTCACGGCGCGCGACATCGACGCCGTAGGCATTCGCGGCGTTGTCGA
CAAGATCCGCCGCCGCGTTGGCAACAGCAGCGTTTATGTCACCGTCGACATCGACGTCCTGGACCCAGCCTTTGC
CCCCGGTACGGGCCCGTGGCCTCTCTCTTCTCCCTCTTGCCCTTGGTGTTGCATGGAACCCATCTGACGAACTGA
CGCTCTCCCCTATAGCGACCGGCACTCCGGAGCCGGGCGGCTGGAGCACGCGTGAGCTCCTCTCGGTCCTGCACG
GCCTCGAGGGCCTCCACGTCGTCGGCAGCGACGTCGTCGAGGTCGCGCCCGCCTACGACTCGAACAGCCAGACGA
CGGCCCTGACGGCCGGCGAGGTCGTCATGTCCCTGCTGGACCTCATGGTCGCGTCGCCCGCCGGCAACGCCTCCT
TGCCCGCTCTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail