Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2138
Gene name
LocationContig_15:21139..22534
Strand-
Gene length (bp)1395
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 1.2E-08 36 202

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 254 276 22
2 289 311 22
3 321 340 19
4 360 382 22
5 387 409 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2138
MALSQRSFAFLLLRVLAVTLAEPVQYCRFGHGHGQIDFCAAMVMHQNQSTSAHDLYLSMTVTRSSPLGWTAIGTG
SVMAGSLMFIVYGDAESGQGPIVSIRTVPAGHAQPRPVDQDDTGPSDIRVVQSTWAAADGTHDDPTWQANIAVVC
YACTRFPSAALSAAATSVPWIWAWNDKQRHSVYSVDAELDMHKHHAGNGGWGNFYVDMARSVSEGERPPSWPRVR
PGIAMLGASDWPSGVASSASALDGNGNPLARLHGLFMATAFLFIFPLGVAAMRSGSAQSFKYHWALQLIGTAFAE
AGAITGICMTGARVASTTRTHGPLGVSVAVLLLVQALAGWRHHVVFVRIRRRTWISHLHIWLGRVSLVASWVNLV
SGLILAGAGRSRVAAMGCFIVLDALGLAIFLWLSKRSARTGSASATAASRDNVDKYFVLGTASDDEDGGEGGGGE
SRELQSVVTCPRFT*
Coding >Hirsu2|2138
ATGGCTCTATCCCAACGTTCGTTCGCCTTCCTACTCTTGCGAGTCTTGGCCGTGACACTTGCCGAGCCGGTGCAG
TACTGCCGCTTCGGTCACGGCCATGGCCAGATCGACTTCTGCGCGGCCATGGTCATGCACCAGAACCAGTCGACG
TCGGCTCACGATCTGTACCTCAGCATGACGGTGACGCGGTCTTCGCCTCTGGGATGGACCGCCATCGGCACGGGG
TCCGTCATGGCCGGCTCCCTCATGTTCATCGTTTACGGTGATGCCGAGTCGGGGCAGGGCCCCATCGTCAGCATC
CGCACCGTCCCTGCCGGACACGCCCAGCCGAGGCCTGTCGACCAGGACGATACGGGCCCGTCGGATATCCGTGTC
GTGCAGTCGACCTGGGCTGCCGCCGACGGTACTCACGATGACCCGACGTGGCAGGCGAACATTGCCGTGGTATGC
TACGCCTGCACGCGGTTCCCCAGCGCCGCCCTGTCTGCGGCCGCGACGTCGGTGCCGTGGATCTGGGCCTGGAAT
GACAAGCAGCGGCACAGCGTCTATTCGGTCGACGCCGAGCTCGATATGCACAAGCACCACGCCGGCAACGGCGGC
TGGGGCAACTTCTACGTCGACATGGCTCGCTCCGTCAGCGAAGGCGAGCGGCCTCCGTCATGGCCTCGTGTGCGC
CCGGGCATCGCCATGCTCGGAGCCTCGGACTGGCCAAGCGGCGTCGCGAGCTCGGCGTCGGCGCTCGATGGAAAT
GGAAACCCCCTTGCCCGGCTGCACGGCCTCTTCATGGCCACGGCCTTCCTCTTCATCTTCCCGCTGGGCGTTGCG
GCCATGCGGTCCGGGTCGGCGCAGTCGTTCAAGTACCACTGGGCTCTGCAGCTCATAGGCACCGCATTCGCCGAG
GCCGGAGCCATCACGGGCATCTGCATGACGGGCGCCCGTGTTGCTTCCACGACCCGGACCCATGGGCCCCTGGGC
GTCTCCGTGGCAGTGCTGCTCCTGGTCCAGGCGTTAGCGGGATGGAGGCATCACGTGGTTTTCGTGCGAATCCGG
CGCCGAACTTGGATTTCTCATCTCCACATCTGGCTGGGCCGCGTCAGCCTCGTCGCTAGCTGGGTCAACCTCGTT
TCTGGCCTGATTCTGGCCGGCGCAGGCCGCAGCCGAGTGGCCGCCATGGGCTGCTTCATCGTCCTGGACGCGCTC
GGTCTGGCCATCTTTCTATGGCTCTCGAAGCGCAGCGCAAGGACAGGCTCAGCATCGGCAACTGCGGCGAGCAGG
GACAACGTCGATAAGTATTTCGTCTTGGGCACGGCAAGCGATGATGAAGACGGAGGTGAAGGAGGGGGAGGAGAG
TCGAGAGAATTGCAGTCGGTTGTCACGTGTCCTCGCTTTACATAA
Transcript >Hirsu2|2138
ATGGCTCTATCCCAACGTTCGTTCGCCTTCCTACTCTTGCGAGTCTTGGCCGTGACACTTGCCGAGCCGGTGCAG
TACTGCCGCTTCGGTCACGGCCATGGCCAGATCGACTTCTGCGCGGCCATGGTCATGCACCAGAACCAGTCGACG
TCGGCTCACGATCTGTACCTCAGCATGACGGTGACGCGGTCTTCGCCTCTGGGATGGACCGCCATCGGCACGGGG
TCCGTCATGGCCGGCTCCCTCATGTTCATCGTTTACGGTGATGCCGAGTCGGGGCAGGGCCCCATCGTCAGCATC
CGCACCGTCCCTGCCGGACACGCCCAGCCGAGGCCTGTCGACCAGGACGATACGGGCCCGTCGGATATCCGTGTC
GTGCAGTCGACCTGGGCTGCCGCCGACGGTACTCACGATGACCCGACGTGGCAGGCGAACATTGCCGTGGTATGC
TACGCCTGCACGCGGTTCCCCAGCGCCGCCCTGTCTGCGGCCGCGACGTCGGTGCCGTGGATCTGGGCCTGGAAT
GACAAGCAGCGGCACAGCGTCTATTCGGTCGACGCCGAGCTCGATATGCACAAGCACCACGCCGGCAACGGCGGC
TGGGGCAACTTCTACGTCGACATGGCTCGCTCCGTCAGCGAAGGCGAGCGGCCTCCGTCATGGCCTCGTGTGCGC
CCGGGCATCGCCATGCTCGGAGCCTCGGACTGGCCAAGCGGCGTCGCGAGCTCGGCGTCGGCGCTCGATGGAAAT
GGAAACCCCCTTGCCCGGCTGCACGGCCTCTTCATGGCCACGGCCTTCCTCTTCATCTTCCCGCTGGGCGTTGCG
GCCATGCGGTCCGGGTCGGCGCAGTCGTTCAAGTACCACTGGGCTCTGCAGCTCATAGGCACCGCATTCGCCGAG
GCCGGAGCCATCACGGGCATCTGCATGACGGGCGCCCGTGTTGCTTCCACGACCCGGACCCATGGGCCCCTGGGC
GTCTCCGTGGCAGTGCTGCTCCTGGTCCAGGCGTTAGCGGGATGGAGGCATCACGTGGTTTTCGTGCGAATCCGG
CGCCGAACTTGGATTTCTCATCTCCACATCTGGCTGGGCCGCGTCAGCCTCGTCGCTAGCTGGGTCAACCTCGTT
TCTGGCCTGATTCTGGCCGGCGCAGGCCGCAGCCGAGTGGCCGCCATGGGCTGCTTCATCGTCCTGGACGCGCTC
GGTCTGGCCATCTTTCTATGGCTCTCGAAGCGCAGCGCAAGGACAGGCTCAGCATCGGCAACTGCGGCGAGCAGG
GACAACGTCGATAAGTATTTCGTCTTGGGCACGGCAAGCGATGATGAAGACGGAGGTGAAGGAGGGGGAGGAGAG
TCGAGAGAATTGCAGTCGGTTGTCACGTGTCCTCGCTTTACATAA
Gene >Hirsu2|2138
ATGGCTCTATCCCAACGTTCGTTCGCCTTCCTACTCTTGCGAGTCTTGGCCGTGACACTTGCCGAGCCGGTGCAG
TACTGCCGCTTCGGTCACGGCCATGGCCAGATCGACTTCTGCGCGGCCATGGTCATGCACCAGAACCAGTCGACG
TCGGCTCACGATCTGTACCTCAGCATGACGGTGACGCGGTCTTCGCCTCTGGGATGGACCGCCATCGGCACGGGG
TCCGTCATGGCCGGCTCCCTCATGTTCATCGTTTACGGTGATGCCGAGTCGGGGCAGGGCCCCATCGTCAGCATC
CGCACCGTCCCTGCCGGACACGCCCAGCCGAGGCCTGTCGACCAGGACGATACGGGCCCGTCGGATATCCGTGTC
GTGCAGTCGACCTGGGCTGCCGCCGACGGTACTCACGATGACCCGACGTGGCAGGCGAACATTGCCGTGGTATGC
TACGCCTGCACGCGGTTCCCCAGCGCCGCCCTGTCTGCGGCCGCGACGTCGGTGCCGTGGATCTGGGCCTGGAAT
GACAAGCAGCGGCACAGCGTCTATTCGGTCGACGCCGAGCTCGATATGCACAAGCACCACGCCGGCAACGGCGGC
TGGGGCAACTTCTACGTCGACATGGCTCGCTCCGTCAGCGAAGGCGAGCGGCCTCCGTCATGGCCTCGTGTGCGC
CCGGGCATCGCCATGCTCGGAGCCTCGGACTGGCCAAGCGGCGTCGCGAGCTCGGCGTCGGCGCTCGATGGAAAT
GGAAACCCCCTTGCCCGGCTGCACGGCCTCTTCATGGCCACGGCCTTCCTCTTCATCTTCCCGCTGGGCGTTGCG
GCCATGCGGTCCGGGTCGGCGCAGTCGTTCAAGTACCACTGGGCTCTGCAGCTCATAGGCACCGCATTCGCCGAG
GCCGGAGCCATCACGGGCATCTGCATGACGGGCGCCCGTGTTGCTTCCACGACCCGGACCCATGGGCCCCTGGGC
GTCTCCGTGGCAGTGCTGCTCCTGGTCCAGGCGTTAGCGGGATGGAGGCATCACGTGGTTTTCGTGCGAATCCGG
CGCCGAACTTGGATTTCTCATCTCCACATCTGGCTGGGCCGCGTCAGCCTCGTCGCTAGCTGGGTCAACCTCGTT
TCTGGCCTGATTCTGGCCGGCGCAGGCCGCAGCCGAGTGGCCGCCATGGGCTGCTTCATCGTCCTGGACGCGCTC
GGTCTGGCCATCTTTCTATGGCTCTCGAAGCGCAGCGCAAGGACAGGCTCAGCATCGGCAACTGCGGCGAGCAGG
GACAACGTCGATAAGTATTTCGTCTTGGGCACGGCAAGCGATGATGAAGACGGAGGTGAAGGAGGGGGAGGAGAG
TCGAGAGAATTGCAGTCGGTTGTCACGTGTCCTCGCTTTACATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail