Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2135
Gene name
LocationContig_15:13224..13991
Strand+
Gene length (bp)767
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit 1.7E-17 61 177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 33 185 9.0E-29
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 49 185 4.0E-15
sp|P41956|C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans GN=mev-1 PE=2 SV=1 25 160 2.0E-12
sp|P41955|C560_CAEBR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis briggsae GN=mev-1 PE=2 SV=1 25 160 3.0E-12
sp|D0VWV4|C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa GN=SDHC PE=1 SV=2 63 185 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 33 185 9.0E-29
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 49 185 4.0E-15
sp|P41956|C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans GN=mev-1 PE=2 SV=1 25 160 2.0E-12
sp|P41955|C560_CAEBR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis briggsae GN=mev-1 PE=2 SV=1 25 160 3.0E-12
sp|D0VWV4|C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa GN=SDHC PE=1 SV=2 63 185 5.0E-12
sp|P35720|C560_BOVIN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Bos taurus GN=SDHC PE=1 SV=2 62 185 8.0E-12
sp|Q9CZB0|C560_MOUSE Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Mus musculus GN=Sdhc PE=1 SV=1 63 166 9.0E-12
sp|P70097|C560_CRIGR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Cricetulus griseus GN=SDHC PE=2 SV=1 64 185 4.0E-11
sp|Q99643|C560_HUMAN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Homo sapiens GN=SDHC PE=1 SV=1 63 168 4.0E-11
sp|P80481|C560_RECAM Succinate dehydrogenase cytochrome b560 subunit OS=Reclinomonas americana GN=SDH3 PE=3 SV=1 57 158 4.0E-08
sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1 54 184 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 88 110 22
2 125 147 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2135
MISQRVGVAALRRGATKPSAFFNQNVPKLILASSMSTTQTRPVATTKISNDDGHQILVKQRLNRPVSPHLGIYKM
EQTWFGASAWTRITGCALSGTAYLYFVSYLVAPLLGLHIESASLAASFAALPLLVKGGIKFALGFPFAFHFFNGL
KHLVYDLGKGFAKPTIKKGEMALWASSILGGLYLAFGL*
Coding >Hirsu2|2135
ATGATCTCGCAACGGGTCGGCGTCGCCGCCCTGCGAAGAGGCGCGACGAAGCCAAGCGCCTTCTTCAACCAGAAC
GTCCCGAAGCTCATCCTCGCCTCGTCCATGTCCACGACCCAAACTCGCCCCGTGGCGACGACGAAAATCTCCAAC
GATGACGGCCACCAGATCCTCGTCAAGCAGCGGCTGAACCGCCCCGTGTCGCCGCACCTCGGCATCTACAAGATG
GAGCAGACGTGGTTCGGCGCCTCGGCCTGGACTCGCATCACCGGCTGCGCCCTCTCCGGCACCGCCTACCTCTAC
TTCGTCTCCTACCTTGTCGCGCCCCTGCTGGGCCTGCACATCGAGAGCGCCAGCTTGGCCGCCTCCTTCGCCGCC
CTGCCCCTGCTCGTCAAGGGCGGCATCAAGTTCGCCCTCGGCTTCCCCTTCGCCTTCCACTTCTTCAACGGCCTC
AAGCACCTCGTCTATGACCTCGGCAAGGGGTTCGCCAAGCCCACCATCAAGAAGGGCGAGATGGCCCTCTGGGCC
TCGAGCATCCTCGGCGGCCTGTACCTCGCCTTCGGCCTGTAG
Transcript >Hirsu2|2135
ATGATCTCGCAACGGGTCGGCGTCGCCGCCCTGCGAAGAGGCGCGACGAAGCCAAGCGCCTTCTTCAACCAGAAC
GTCCCGAAGCTCATCCTCGCCTCGTCCATGTCCACGACCCAAACTCGCCCCGTGGCGACGACGAAAATCTCCAAC
GATGACGGCCACCAGATCCTCGTCAAGCAGCGGCTGAACCGCCCCGTGTCGCCGCACCTCGGCATCTACAAGATG
GAGCAGACGTGGTTCGGCGCCTCGGCCTGGACTCGCATCACCGGCTGCGCCCTCTCCGGCACCGCCTACCTCTAC
TTCGTCTCCTACCTTGTCGCGCCCCTGCTGGGCCTGCACATCGAGAGCGCCAGCTTGGCCGCCTCCTTCGCCGCC
CTGCCCCTGCTCGTCAAGGGCGGCATCAAGTTCGCCCTCGGCTTCCCCTTCGCCTTCCACTTCTTCAACGGCCTC
AAGCACCTCGTCTATGACCTCGGCAAGGGGTTCGCCAAGCCCACCATCAAGAAGGGCGAGATGGCCCTCTGGGCC
TCGAGCATCCTCGGCGGCCTGTACCTCGCCTTCGGCCTGTAG
Gene >Hirsu2|2135
ATGATCTCGCAACGGGTCGGCGTCGCCGCCCTGCGAAGAGGTAACCACGCTGTCCGGAAGAGAGATATGTCGTTC
TCACGCGGCGAGCTGGCGGGCTGACCGGATGGCCGTGTGTCGTCGTTTCCTGCCAGGCGCGACGAAGCCAAGCGC
CTTCTTCAACCAGAACGTCCCGAAGCTCATCCTCGCCTCGTCCATGTCCACGACCCAAACTCGGTGAGGGAAATC
CTCCCGCGCTCTTTGTTTTTTTTGTTTCCACGATCCCTCCATCCGCCGGTTCTCGCGCCGGAAGACGGAGCCCAA
GGCTGACGAGGGCCCGATCCAGCCCCGTGGCGACGACGAAAATCTCCAACGATGACGGCCACCAGATCCTCGTCA
AGCAGCGGCTGAACCGCCCCGTGTCGCCGCACCTCGGCATCTACAAGATGGAGCAGACGTGGTTCGGCGCCTCGG
CCTGGACTCGCATCACCGGCTGCGCCCTCTCCGGCACCGCCTACCTCTACTTCGTCTCCTACCTTGTCGCGCCCC
TGCTGGGCCTGCACATCGAGAGCGCCAGCTTGGCCGCCTCCTTCGCCGCCCTGCCCCTGCTCGTCAAGGGCGGCA
TCAAGTTCGCCCTCGGCTTCCCCTTCGCCTTCCACTTCTTCAACGGCCTCAAGCACCTCGTCTATGACCTCGGCA
AGGGGTTCGCCAAGCCCACCATCAAGAAGGGCGAGATGGCCCTCTGGGCCTCGAGCATCCTCGGCGGCCTGTACC
TCGCCTTCGGCCTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail