Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2134
Gene name
LocationContig_15:11503..11974
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Cell membrane 0.5125 0.2261 0.2998 0.578 0.2255 0.1451 0.34 0.3497 0.2297 0.0652

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 44 31
2 49 71 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 10 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8991
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2134 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2134
MSSRAAVLTVADCLAGTAFVLGADAFALTAVLLTGAVLALALALALALALSLLGCFALTICLLGCFVLALLHCSY
HRLRRRVSAASPPPPPPPPPRPRRCSRLIRAAMPHRHATAEIRANNKAGPLRTPASAGGGPESTSPPHFVGGDDA
TRFEMA*
Coding >Hirsu2|2134
ATGTCCAGCCGCGCCGCCGTCCTCACCGTCGCCGACTGCCTCGCCGGCACGGCCTTCGTCCTCGGCGCCGACGCC
TTCGCACTCACCGCCGTGCTCCTGACCGGCGCCGTGCTCGCCCTCGCCCTCGCCCTCGCCCTCGCCCTCGCCCTG
AGTCTTCTCGGCTGCTTCGCCCTAACCATATGCCTGCTCGGCTGCTTCGTCCTCGCCCTGCTGCACTGCTCCTAC
CACCGGCTCCGCCGACGTGTCAGTGCGGCGTCACCGCCGCCGCCGCCGCCACCGCCGCCTCGGCCGCGTAGGTGC
TCACGTCTCATACGCGCCGCCATGCCGCACCGTCATGCGACGGCCGAGATCCGGGCCAACAACAAGGCCGGGCCG
TTGCGTACCCCTGCGAGTGCCGGCGGCGGCCCGGAGTCGACATCTCCACCTCACTTTGTCGGCGGAGACGACGCC
ACACGATTTGAGATGGCCTGA
Transcript >Hirsu2|2134
ATGTCCAGCCGCGCCGCCGTCCTCACCGTCGCCGACTGCCTCGCCGGCACGGCCTTCGTCCTCGGCGCCGACGCC
TTCGCACTCACCGCCGTGCTCCTGACCGGCGCCGTGCTCGCCCTCGCCCTCGCCCTCGCCCTCGCCCTCGCCCTG
AGTCTTCTCGGCTGCTTCGCCCTAACCATATGCCTGCTCGGCTGCTTCGTCCTCGCCCTGCTGCACTGCTCCTAC
CACCGGCTCCGCCGACGTGTCAGTGCGGCGTCACCGCCGCCGCCGCCGCCACCGCCGCCTCGGCCGCGTAGGTGC
TCACGTCTCATACGCGCCGCCATGCCGCACCGTCATGCGACGGCCGAGATCCGGGCCAACAACAAGGCCGGGCCG
TTGCGTACCCCTGCGAGTGCCGGCGGCGGCCCGGAGTCGACATCTCCACCTCACTTTGTCGGCGGAGACGACGCC
ACACGATTTGAGATGGCCTGA
Gene >Hirsu2|2134
ATGTCCAGCCGCGCCGCCGTCCTCACCGTCGCCGACTGCCTCGCCGGCACGGCCTTCGTCCTCGGCGCCGACGCC
TTCGCACTCACCGCCGTGCTCCTGACCGGCGCCGTGCTCGCCCTCGCCCTCGCCCTCGCCCTCGCCCTCGCCCTG
AGTCTTCTCGGCTGCTTCGCCCTAACCATATGCCTGCTCGGCTGCTTCGTCCTCGCCCTGCTGCACTGCTCCTAC
CACCGGCTCCGCCGACGTGTCAGTGCGGCGTCACCGCCGCCGCCGCCGCCACCGCCGCCTCGGCCGCGTAGGTGC
TCACGTCTCATACGCGCCGCCATGCCGCACCGTCATGCGACGGCCGAGATCCGGGCCAACAACAAGGCCGGGCCG
TTGCGTACCCCTGCGAGTGCCGGCGGCGGCCCGGAGTCGACATCTCCACCTCACTTTGTCGGCGGAGACGACGCC
ACACGATTTGAGATGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail