Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2131
Gene name
LocationContig_15:817..2601
Strand-
Gene length (bp)1784
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide|Transmembrane domain 0.2633 0.2066 0.41 0.2717 0.1672 0.0249 0.2994 0.2687 0.3843 0.1213

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup512
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2331
Ophiocordyceps australis 1348a (Ghana) OphauG2|6294
Ophiocordyceps australis map64 (Brazil) OphauB2|4358
Ophiocordyceps camponoti-floridani Ophcf2|01590
Ophiocordyceps camponoti-rufipedis Ophun1|955
Ophiocordyceps kimflemingae Ophio5|2953
Ophiocordyceps subramaniannii Hirsu2|2131 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2131
MQSVLRTLEVSYSKDLSALYSNDFWALRHTRGRHPHHYAYFAKPGCYFTSPRTLSPRNSLTGPSLSSTAADESLY
TCLFLPYLHFDSYKRLIRRRNLILQRLNYGRARPVPESVAKSDLLELQVMWEFLGHDPPINCRRTLDQYGCPSLR
DTRSRDDDQMLYKLTKERGLGALLDPANDMRHQSSTTGTGTGSDRGGSGASTTSGGWRERLTRRHGGDVVDDAPE
EETVLDGNVLMVDQLWLWVIQPHTLVSFFPKRESDPIEGPLFQHSDLRDSIFNDVNVDLTRQCENALDLAALAAL
HAVSVLLDRSSHPDLEVFRIFEEAISALTEKLTWSLKTFRTEGFRDKAFDYEPVENKARSIRARHKEEGRRAERE
NRDNTSALLELRDIEDELLTLVHLFEQQSKVLSSMHATYTRPEMRDRTVNGRVFLAEALKRLRDYVHQADEMIQR
VRSTRDDYDKLAAA*
Coding >Hirsu2|2131
ATGCAGAGCGTGCTCCGAACATTGGAGGTCTCGTACAGCAAAGACTTGTCGGCCTTGTACAGCAACGATTTCTGG
GCCCTCAGACACACGCGAGGGCGACACCCGCACCACTATGCCTACTTTGCCAAGCCGGGCTGCTACTTTACGTCT
CCACGAACCTTATCCCCGCGCAACTCCTTGACGGGCCCCTCGCTGTCGTCCACTGCGGCAGACGAGTCGCTCTAC
ACATGTCTCTTCCTCCCATACCTCCACTTCGACTCTTACAAAAGGTTGATCCGACGACGCAACCTCATTCTCCAG
CGCCTCAACTATGGCCGCGCTCGCCCGGTGCCCGAGTCGGTTGCCAAGTCAGACTTGCTGGAACTGCAGGTCATG
TGGGAGTTTCTCGGACACGACCCACCCATCAACTGCCGTCGAACGCTAGATCAGTACGGCTGCCCGTCTCTCAGG
GACACGAGATCTCGGGACGACGACCAGATGCTCTACAAGCTTACCAAGGAAAGGGGCCTCGGTGCCTTGTTGGAC
CCAGCCAACGACATGCGCCACCAGAGCTCGACGACGGGCACGGGGACCGGCTCCGACAGGGGCGGCAGCGGGGCC
AGCACTACATCTGGCGGCTGGCGAGAGAGACTGACGCGCAGGCACGGGGGCGATGTTGTCGACGATGCGCCGGAG
GAGGAGACGGTGCTCGACGGCAATGTGCTCATGGTCGATCAGCTCTGGCTATGGGTCATACAACCGCACACCCTG
GTTTCGTTCTTCCCGAAGCGAGAGAGCGATCCGATCGAGGGCCCGCTGTTCCAGCACTCGGATCTCCGCGACAGC
ATCTTCAACGATGTCAACGTCGACCTCACGAGGCAGTGCGAGAACGCACTGGACCTCGCCGCCTTGGCAGCTCTG
CATGCCGTGAGCGTCCTCCTCGACCGCTCTTCTCACCCGGACCTGGAAGTGTTTCGCATTTTTGAGGAGGCTATT
AGCGCGCTGACGGAGAAACTCACCTGGTCGCTCAAGACGTTCCGCACTGAAGGCTTCCGCGACAAAGCATTTGAC
TATGAGCCAGTGGAAAATAAGGCGAGGTCGATCCGGGCAAGGCACAAGGAAGAGGGCCGACGGGCGGAGCGGGAG
AACCGCGACAACACGTCGGCGCTGCTGGAGCTACGGGACATCGAGGACGAGCTGCTAACGCTGGTGCACCTGTTC
GAGCAGCAGTCCAAGGTGCTGTCGTCGATGCACGCGACGTACACGCGGCCGGAGATGCGAGACCGGACGGTCAAC
GGGCGCGTCTTCCTGGCCGAGGCGCTCAAGCGGCTGCGCGACTACGTGCACCAGGCGGACGAGATGATCCAGCGG
GTGCGCAGCACGCGCGACGACTACGACAAGCTAGCCGCAGCGTGA
Transcript >Hirsu2|2131
ATGCAGAGCGTGCTCCGAACATTGGAGGTCTCGTACAGCAAAGACTTGTCGGCCTTGTACAGCAACGATTTCTGG
GCCCTCAGACACACGCGAGGGCGACACCCGCACCACTATGCCTACTTTGCCAAGCCGGGCTGCTACTTTACGTCT
CCACGAACCTTATCCCCGCGCAACTCCTTGACGGGCCCCTCGCTGTCGTCCACTGCGGCAGACGAGTCGCTCTAC
ACATGTCTCTTCCTCCCATACCTCCACTTCGACTCTTACAAAAGGTTGATCCGACGACGCAACCTCATTCTCCAG
CGCCTCAACTATGGCCGCGCTCGCCCGGTGCCCGAGTCGGTTGCCAAGTCAGACTTGCTGGAACTGCAGGTCATG
TGGGAGTTTCTCGGACACGACCCACCCATCAACTGCCGTCGAACGCTAGATCAGTACGGCTGCCCGTCTCTCAGG
GACACGAGATCTCGGGACGACGACCAGATGCTCTACAAGCTTACCAAGGAAAGGGGCCTCGGTGCCTTGTTGGAC
CCAGCCAACGACATGCGCCACCAGAGCTCGACGACGGGCACGGGGACCGGCTCCGACAGGGGCGGCAGCGGGGCC
AGCACTACATCTGGCGGCTGGCGAGAGAGACTGACGCGCAGGCACGGGGGCGATGTTGTCGACGATGCGCCGGAG
GAGGAGACGGTGCTCGACGGCAATGTGCTCATGGTCGATCAGCTCTGGCTATGGGTCATACAACCGCACACCCTG
GTTTCGTTCTTCCCGAAGCGAGAGAGCGATCCGATCGAGGGCCCGCTGTTCCAGCACTCGGATCTCCGCGACAGC
ATCTTCAACGATGTCAACGTCGACCTCACGAGGCAGTGCGAGAACGCACTGGACCTCGCCGCCTTGGCAGCTCTG
CATGCCGTGAGCGTCCTCCTCGACCGCTCTTCTCACCCGGACCTGGAAGTGTTTCGCATTTTTGAGGAGGCTATT
AGCGCGCTGACGGAGAAACTCACCTGGTCGCTCAAGACGTTCCGCACTGAAGGCTTCCGCGACAAAGCATTTGAC
TATGAGCCAGTGGAAAATAAGGCGAGGTCGATCCGGGCAAGGCACAAGGAAGAGGGCCGACGGGCGGAGCGGGAG
AACCGCGACAACACGTCGGCGCTGCTGGAGCTACGGGACATCGAGGACGAGCTGCTAACGCTGGTGCACCTGTTC
GAGCAGCAGTCCAAGGTGCTGTCGTCGATGCACGCGACGTACACGCGGCCGGAGATGCGAGACCGGACGGTCAAC
GGGCGCGTCTTCCTGGCCGAGGCGCTCAAGCGGCTGCGCGACTACGTGCACCAGGCGGACGAGATGATCCAGCGG
GTGCGCAGCACGCGCGACGACTACGACAAGCTAGCCGCAGCGTGA
Gene >Hirsu2|2131
ATGCAGAGCGTGCTCCGAACATTGGAGGTCTCGTACAGCAAAGACTTGTCGGCCTTGTACAGCAACGATTTCTGG
GCCCTCAGACACACGCGAGGGCGACACCCGCACCACTATGCCTACTTTGCCAAGCCGGGCTGCTACTTTACGTCT
CCACGAACCTGCAAGTCTTCATTTCCCCCCTCCTTGTCATCCCTCAAATCCTTGCTGACCACCGGCCCTGACAGT
ATCCCCGCGCAACTCCTTGACGGGCCCCTCGCTGTCGTCCACTGCGGCAGACGAGTCGCTCTACACATGTCTCTT
CCTCCCATACCTCCACTTCGACTCTTACAAAAGGTTGATCCGACGACGCAACCTCATTCTCCAGCGCCTCAACTA
TGGCCGCGCTCGCCCGGTGCCCGAGTCGGTTGCCAAGTCAGACTTGCTGGAACTGCAGGTCATGTGGGAGTTTCT
CGGACACGACCCACCCATCAACTGCCGTCGAACGCTAGATCAGTACGGCTGCCCGTCTCTCAGGGACACGAGATC
TCGGGACGACGACCAGATGCTCTACAAGCTTACCAAGGAAAGGGGCCTCGGTGCCTTGTTGGACCCAGCCAACGA
CATGCGCCACCAGAGCTCGACGACGGGCACGGGGACCGGCTCCGACAGGGGCGGCAGCGGGGCCAGCACTACATC
TGGCGGCTGGCGAGAGAGACTGACGCGCAGGCACGGGGGCGATGTTGTCGACGATGCGCCGGAGGAGGAGACGGT
GCTCGACGGCAATGTGCTCATGGTCGATCAGCTCTGGCTATGGGTCATACAACCGCGTAGGTCCCTCCCTTATTC
AGACGGACGCCCTCGAAACCCTCCTCTTTCCCCACGTTTTCTTTCAGCGATCGGAGACACTCCTCTGGGGCCGTC
CTTTCGCAGACAGCTGACGGTCCGACCTAGACACCCTGGTTTCGTTCTTCCCGAAGCGAGAGAGCGATCCGATCG
AGGGCCCGCTGTTCCAGCACTCGGATCTCCGCGACAGCATCTTCAACGATGTCAACGTCGACCTCACGAGGCAGT
GCGAGAACGCACTGGACCTCGCCGCCTTGGCAGCTCTGCATGCCGTGAGCGTCCTCCTCGACCGCTCTTCTCACC
CGGACCTGGAAGTGTTTCGCATTTTTGAGGAGGCTATTAGCGCGCTGGTAAGTCTTGTAGCATCCCCCCCCTCTT
CCCCTCTGCCTCCTATCTATCGGTCTCCCTGAAGAGATTGGTGAGCTGCATGGAAATCAAGATCGTTGACTGACG
TCCCCTGTTTCCCTCCTAGACGGAGAAACTCACCTGGTCGCTCAAGACGTTCCGCACTGAAGGCTTCCGCGACAA
AGCATTTGACTATGAGCCAGTGGAAAATAAGGCGAGGTCGATCCGGGCAAGGCACAAGGAAGAGGGCCGACGGGC
GGAGCGGGAGAACCGCGACAACACGTCGGCGCTGCTGGAGCTACGGGACATCGAGGACGAGCTGCTAACGCTGGT
GCACCTGTTCGAGCAGCAGTCCAAGGTGCTGTCGTCGATGCACGCGACGTACACGCGGCCGGAGATGCGAGACCG
GACGGTCAACGGGCGCGTCTTCCTGGCCGAGGCGCTCAAGCGGCTGCGCGACTACGTGCACCAGGCGGACGAGAT
GATCCAGCGGGTGCGCAGCACGCGCGACGACTACGACAAGCTGTTGCAGATGGTGCAGCGGCAGGCGCAGGTGGA
CGAGGTGCGCATCAGCCGACTGCACGCCGACCTGGCCAGCGCGCAGAGCCGCAGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail