Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2118
Gene name
LocationContig_1494:1360..3850
Strand-
Gene length (bp)2490
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 1.3E-53 92 253
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 5.0E-47 500 646
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 1.2E-38 291 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07342|ILVB_YEAST Acetolactate synthase catalytic subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV2 PE=1 SV=1 56 691 0.0E+00
sp|P36620|ILVB_SCHPO Acetolactate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv1 PE=3 SV=2 83 672 0.0E+00
sp|Q5KPJ5|ILVB_CRYNJ Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|Q6SSJ3|ILVB_CRYNH Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 92 669 1.0E-149
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07342|ILVB_YEAST Acetolactate synthase catalytic subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV2 PE=1 SV=1 56 691 0.0E+00
sp|P36620|ILVB_SCHPO Acetolactate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv1 PE=3 SV=2 83 672 0.0E+00
sp|Q5KPJ5|ILVB_CRYNJ Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|Q6SSJ3|ILVB_CRYNH Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 92 669 1.0E-149
sp|P27819|ILVB3_BRANA Acetolactate synthase 3, chloroplastic OS=Brassica napus PE=3 SV=1 22 669 2.0E-148
sp|P17597|ILVB_ARATH Acetolactate synthase, chloroplastic OS=Arabidopsis thaliana GN=ALS PE=1 SV=1 91 669 3.0E-148
sp|P27818|ILVB1_BRANA Acetolactate synthase 1, chloroplastic OS=Brassica napus PE=3 SV=1 22 669 8.0E-148
sp|P09342|ILVB1_TOBAC Acetolactate synthase 1, chloroplastic OS=Nicotiana tabacum GN=ALS SURA PE=1 SV=1 81 669 2.0E-145
sp|P09114|ILVB2_TOBAC Acetolactate synthase 2, chloroplastic OS=Nicotiana tabacum GN=ALS SURB PE=1 SV=1 91 669 7.0E-145
sp|Q6K2E8|ILVB1_ORYSJ Acetolactate synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS1 PE=2 SV=1 91 670 1.0E-143
sp|Q57725|ILVB_METJA Probable acetolactate synthase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvB PE=3 SV=1 92 665 1.0E-142
sp|Q9RQ65|ILVI_BUCSC Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=ilvI PE=3 SV=1 92 634 8.0E-142
sp|Q41768|ILVB1_MAIZE Acetolactate synthase 1, chloroplastic OS=Zea mays GN=ALS1 PE=3 SV=1 91 670 1.0E-141
sp|P00892|ILVG_ECOLI Acetolactate synthase isozyme 2 large subunit OS=Escherichia coli (strain K12) GN=ilvG PE=1 SV=3 104 669 2.0E-139
sp|O85293|ILVI_BUCAP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ilvI PE=3 SV=1 92 675 7.0E-139
sp|P57321|ILVI_BUCAI Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ilvI PE=3 SV=1 92 675 1.0E-138
sp|P45261|ILVI_HAEIN Acetolactate synthase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvI PE=3 SV=1 92 676 1.0E-137
sp|P0A623|ILVB_MYCBO Acetolactate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvB PE=3 SV=1 105 668 1.0E-136
sp|P9WG41|ILVB1_MYCTU Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB1 PE=1 SV=1 105 668 1.0E-136
sp|P9WG40|ILVB1_MYCTO Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvB1 PE=3 SV=1 105 668 1.0E-136
sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme 3 large subunit OS=Escherichia coli (strain K12) GN=ilvI PE=1 SV=2 92 674 5.0E-136
sp|Q1XDF6|ILVB_PYRYE Acetolactate synthase large subunit OS=Pyropia yezoensis GN=ilvB PE=3 SV=1 91 664 6.0E-136
sp|O33112|ILVB_MYCLE Acetolactate synthase OS=Mycobacterium leprae (strain TN) GN=ilvB PE=3 SV=1 106 676 7.0E-136
sp|Q41769|ILVB2_MAIZE Acetolactate synthase 2, chloroplastic OS=Zea mays GN=ALS2 PE=3 SV=1 91 670 1.0E-135
sp|Q7U5G1|ILVB_SYNPX Acetolactate synthase large subunit OS=Synechococcus sp. (strain WH8102) GN=ilvB PE=3 SV=1 92 664 2.0E-135
sp|P14874|ILVB2_BRANA Acetolactate synthase 2, chloroplastic OS=Brassica napus PE=3 SV=1 62 670 1.0E-134
sp|P08142|ILVB_ECOLI Acetolactate synthase isozyme 1 large subunit OS=Escherichia coli (strain K12) GN=ilvB PE=1 SV=1 92 669 2.0E-133
sp|P42463|ILVB_CORGL Acetolactate synthase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvB PE=3 SV=1 109 664 5.0E-133
sp|P40811|ILVI_SALTY Acetolactate synthase isozyme 3 large subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvI PE=3 SV=3 92 674 5.0E-133
sp|P69684|ILVB_PORUM Acetolactate synthase large subunit OS=Porphyra umbilicalis GN=ilvB PE=3 SV=1 84 664 7.0E-132
sp|P69683|ILVB_PORPU Acetolactate synthase large subunit OS=Porphyra purpurea GN=ilvB PE=3 SV=1 84 664 7.0E-132
sp|O78518|ILVB_GUITH Acetolactate synthase large subunit OS=Guillardia theta GN=ilvB PE=3 SV=1 101 664 1.0E-131
sp|Q02137|ILVB_LACLA Acetolactate synthase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvB PE=3 SV=2 92 662 8.0E-131
sp|Q89AP7|ILVI_BUCBP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ilvI PE=3 SV=1 92 628 4.0E-130
sp|O19929|ILVB_CYACA Acetolactate synthase large subunit OS=Cyanidium caldarium GN=ilvB PE=3 SV=1 91 669 5.0E-130
sp|Q59498|ILVB_MYCAV Acetolactate synthase OS=Mycobacterium avium GN=ilvB PE=3 SV=1 105 676 2.0E-129
sp|Q7XKQ8|ILVB2_ORYSJ Probable acetolactate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS2 PE=2 SV=2 91 670 2.0E-128
sp|O08353|ILVB_METAO Probable acetolactate synthase large subunit OS=Methanococcus aeolicus GN=ilvB PE=3 SV=1 92 686 4.0E-127
sp|P27868|ILVB_ARTPT Acetolactate synthase (Fragment) OS=Arthrospira platensis GN=ilvY PE=3 SV=1 103 662 2.0E-124
sp|P0AEP7|GCL_ECOLI Glyoxylate carboligase OS=Escherichia coli (strain K12) GN=gcl PE=1 SV=2 103 677 3.0E-70
sp|P0AEP8|GCL_ECO57 Glyoxylate carboligase OS=Escherichia coli O157:H7 GN=gcl PE=3 SV=2 103 677 3.0E-70
sp|Q93PS3|XSC_DESTI Sulfoacetaldehyde acetyltransferase OS=Desulfonispora thiosulfatigenes GN=xsc PE=1 SV=1 95 653 3.0E-59
sp|Q04789|ILVX_BACSU Acetolactate synthase OS=Bacillus subtilis (strain 168) GN=alsS PE=2 SV=3 86 650 2.0E-57
sp|P96591|YDAP_BACSU Putative thiamine pyrophosphate-containing protein YdaP OS=Bacillus subtilis (strain 168) GN=ydaP PE=2 SV=1 91 664 1.0E-56
sp|Q84H44|XSC_CASDE Sulfoacetaldehyde acetyltransferase OS=Castellaniella defragrans GN=xsc PE=1 SV=3 95 659 6.0E-50
sp|Q84H41|XSC_ALCXX Sulfoacetaldehyde acetyltransferase OS=Alcaligenes xylosoxydans xylosoxydans GN=xsc PE=1 SV=3 95 638 5.0E-49
sp|D5AKX8|XSC_RHOCB Sulfoacetaldehyde acetyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=xsc PE=2 SV=1 95 603 4.0E-46
sp|P27696|ILVB_KLEPN Acetolactate synthase, catabolic OS=Klebsiella pneumoniae GN=budB PE=1 SV=1 93 652 6.0E-43
sp|Q54970|POXB_STRPN Pyruvate oxidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=spxB PE=3 SV=2 105 615 9.0E-41
sp|Q04524|ILVB_RAOTE Acetolactate synthase, catabolic OS=Raoultella terrigena GN=budB PE=3 SV=1 93 652 1.0E-38
sp|P07003|POXB_ECOLI Pyruvate dehydrogenase [ubiquinone] OS=Escherichia coli (strain K12) GN=poxB PE=1 SV=1 105 657 1.0E-37
sp|Q58077|Y663_METJA Uncharacterized protein MJ0663 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0663 PE=3 SV=1 93 652 1.0E-37
sp|Q92UW6|XSC_RHIME Probable sulfoacetaldehyde acetyltransferase OS=Rhizobium meliloti (strain 1021) GN=xsc PE=3 SV=1 95 633 7.0E-37
sp|P37063|POXB_LACPL Pyruvate oxidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pox5 PE=1 SV=3 105 654 2.0E-36
sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=1 SV=1 79 581 2.0E-35
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 130 584 1.0E-32
sp|P0CH62|CHDH_AZOSP Cyclohexane-1,2-dione hydrolase OS=Azoarcus sp. PE=1 SV=1 91 651 6.0E-32
sp|O05031|Y737_HAEIN Putative uncharacterized protein HI_0737 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0737 PE=5 SV=1 92 221 4.0E-31
sp|Q6NV04|ILVBL_DANRE Acetolactate synthase-like protein OS=Danio rerio GN=ilvbl PE=2 SV=1 91 591 1.0E-28
sp|A1L0T0|ILVBL_HUMAN Acetolactate synthase-like protein OS=Homo sapiens GN=ILVBL PE=1 SV=2 91 581 2.0E-28
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 98 653 1.0E-27
sp|Q0JMH0|HACL_ORYSJ 2-hydroxyacyl-CoA lyase OS=Oryza sativa subsp. japonica GN=Os01g0505400 PE=3 SV=3 108 581 3.0E-27
sp|Q9LCV9|CEAS_STRCL N(2)-(2-carboxyethyl)arginine synthase OS=Streptomyces clavuligerus GN=ceaS PE=1 SV=1 120 646 4.0E-27
sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 78 650 1.0E-26
sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 78 652 1.0E-26
sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 92 650 3.0E-26
sp|A6QQT9|ILVBL_BOVIN Acetolactate synthase-like protein OS=Bos taurus GN=ILVBL PE=2 SV=2 91 581 9.0E-26
sp|O61856|ILVBL_CAEEL Acetolactate synthase-like protein OS=Caenorhabditis elegans GN=T26C12.1 PE=3 SV=2 91 581 7.0E-25
sp|Q6DDK5|ILVBL_XENLA Acetolactate synthase-like protein OS=Xenopus laevis GN=ilvbl PE=2 SV=1 93 569 2.0E-24
sp|Q8Y9Y1|IOLD_LISMO 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=iolD PE=3 SV=1 88 634 5.0E-24
sp|P0AFI0|OXC_ECOLI Oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1 84 581 5.0E-24
sp|P0AFI1|OXC_ECO57 Oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1 84 581 5.0E-24
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 98 654 1.0E-23
sp|Q92EQ4|IOLD_LISIN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=iolD PE=3 SV=1 105 634 2.0E-23
sp|Q723S8|IOLD_LISMF 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=iolD PE=3 SV=2 88 634 6.0E-23
sp|P9WG39|ILVG_MYCTU Acetolactate synthase large subunit IlvG OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvG PE=1 SV=1 94 653 7.0E-23
sp|P9WG38|ILVG_MYCTO Acetolactate synthase large subunit IlvG OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvG PE=3 SV=1 94 653 7.0E-23
sp|P66947|ILVG_MYCBO Probable acetolactate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvG PE=3 SV=1 94 653 7.0E-23
sp|Q8BU33|ILVBL_MOUSE Acetolactate synthase-like protein OS=Mus musculus GN=Ilvbl PE=1 SV=1 83 581 1.0E-22
sp|Q9KAG9|IOLD_BACHD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=iolD PE=3 SV=1 98 634 2.0E-22
sp|Q5WKY8|IOLD_BACSK 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus clausii (strain KSM-K16) GN=iolD PE=3 SV=1 104 614 3.0E-22
sp|A5YBJ6|IOLD_LACCA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Lactobacillus casei GN=iolD PE=3 SV=2 104 625 3.0E-22
sp|Q4V1F5|IOLD2_BACCZ 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 2 OS=Bacillus cereus (strain ZK / E33L) GN=iolD2 PE=3 SV=1 104 634 2.0E-21
sp|Q5KYR0|IOLD_GEOKA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Geobacillus kaustophilus (strain HTA426) GN=iolD PE=3 SV=1 98 591 8.0E-21
sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 93 581 2.0E-20
sp|B7JPM3|IOLD_BACC0 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus cereus (strain AH820) GN=iolD PE=3 SV=1 104 591 2.0E-20
sp|P42415|IOLD_BACSU 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus subtilis (strain 168) GN=iolD PE=1 SV=2 104 646 3.0E-20
sp|Q0TUZ2|IOLD_CLOP1 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=iolD PE=3 SV=1 84 591 6.0E-20
sp|Q9HUI8|ARUI_PSEAE Probable 2-ketoarginine decarboxylase AruI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruI PE=1 SV=1 92 254 6.0E-20
sp|A7ZAH8|IOLD_BACMF 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolD PE=3 SV=1 104 646 5.0E-19
sp|Q65D03|IOLD_BACLD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=iolD PE=3 SV=1 104 614 7.0E-19
sp|B2V4K0|IOLD_CLOBA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=iolD PE=3 SV=1 84 614 9.0E-19
sp|C1EVJ3|IOLD_BACC3 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus cereus (strain 03BB102) GN=iolD PE=3 SV=1 104 591 2.0E-18
sp|A0REB6|IOLD_BACAH 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus thuringiensis (strain Al Hakam) GN=iolD PE=3 SV=1 104 591 2.0E-18
sp|A4IPB6|IOLD_GEOTN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolD PE=3 SV=1 104 591 7.0E-18
sp|P10343|YI42_PSEAY Uncharacterized 42.6 kDa protein in isoamylase 3'region OS=Pseudomonas amyloderamosa PE=4 SV=1 95 520 2.0E-17
sp|P39994|YEC0_YEAST Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL020C PE=1 SV=1 97 581 1.0E-16
sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 132 331 3.0E-16
sp|Q9P7P6|PDC3_SCHPO Probable pyruvate decarboxylase C186.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.09 PE=3 SV=1 101 651 3.0E-16
sp|Q9Y7M1|YGK4_SCHPO Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.04 PE=3 SV=1 92 582 4.0E-16
sp|P51853|BZNB_PSEFL Benzaldehyde lyase OS=Pseudomonas fluorescens GN=bznB PE=1 SV=1 92 593 8.0E-14
sp|Q81QB5|IOLD_BACAN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus anthracis GN=iolD PE=3 SV=1 104 389 3.0E-13
sp|C3LHY1|IOLD_BACAC 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=iolD PE=3 SV=1 104 389 3.0E-13
sp|C3PAZ3|IOLD_BACAA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus anthracis (strain A0248) GN=iolD PE=3 SV=1 104 389 3.0E-13
sp|Q6HIK2|IOLD_BACHK 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=iolD PE=3 SV=1 104 389 4.0E-13
sp|Q63B73|IOLD1_BACCZ 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 1 OS=Bacillus cereus (strain ZK / E33L) GN=iolD1 PE=3 SV=1 104 389 5.0E-13
sp|P23234|DCIP_ENTCL Indole-3-pyruvate decarboxylase OS=Enterobacter cloacae GN=ipdC PE=1 SV=1 105 651 9.0E-13
sp|Q09737|PDC1_SCHPO Putative pyruvate decarboxylase C13A11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13A11.06 PE=3 SV=2 94 629 6.0E-11
sp|P9WG37|KDC_MYCTU Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdc PE=1 SV=1 94 582 6.0E-11
sp|A5U0P1|KDC_MYCTA Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kdc PE=3 SV=1 94 582 6.0E-11
sp|A1KGY5|KDC_MYCBP Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kdc PE=3 SV=1 94 582 6.0E-11
sp|Q7U140|KDC_MYCBO Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdc PE=3 SV=1 94 582 6.0E-11
sp|A1BI74|MEND_CHLPD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=menD PE=3 SV=1 99 615 1.0E-10
sp|P9WG36|KDC_MYCTO Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdc PE=3 SV=1 94 582 2.0E-10
sp|P83779|PDC1_CANAL Pyruvate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PDC11 PE=1 SV=2 94 582 9.0E-10
sp|Q898E8|IOLD_CLOTE 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Clostridium tetani (strain Massachusetts / E88) GN=iolD PE=3 SV=2 98 383 3.0E-09
sp|B3QL00|MEND_CHLP8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=menD PE=3 SV=1 84 249 3.0E-09
sp|P34734|PDC_HANUV Pyruvate decarboxylase OS=Hanseniaspora uvarum GN=PDC PE=3 SV=1 94 387 4.0E-09
sp|A0PL16|KDC_MYCUA Alpha-keto-acid decarboxylase OS=Mycobacterium ulcerans (strain Agy99) GN=kdc PE=3 SV=1 94 582 5.0E-09
sp|Q9M039|PDC3_ARATH Pyruvate decarboxylase 3 OS=Arabidopsis thaliana GN=PDC3 PE=2 SV=1 101 581 7.0E-09
sp|P16467|PDC5_YEAST Pyruvate decarboxylase isozyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC5 PE=1 SV=4 94 581 3.0E-08
sp|Q9M040|PDC4_ARATH Pyruvate decarboxylase 4 OS=Arabidopsis thaliana GN=PDC4 PE=2 SV=1 101 581 4.0E-08
sp|B3EG68|MEND_CHLL2 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=menD PE=3 SV=1 138 249 5.0E-08
sp|B4SET5|MEND_PELPB 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=menD PE=3 SV=1 84 334 8.0E-08
sp|Q2LXE3|MEND_SYNAS 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Syntrophus aciditrophicus (strain SB) GN=menD PE=3 SV=2 101 212 2.0E-07
sp|A4SD60|MEND_CHLPM 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=menD PE=3 SV=1 99 332 3.0E-07
sp|P06169|PDC1_YEAST Pyruvate decarboxylase isozyme 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC1 PE=1 SV=7 94 582 4.0E-07
sp|Q8KBE8|MEND_CHLTE 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=menD PE=3 SV=2 99 249 5.0E-07
sp|Q8E8T4|MEND_SHEON 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella oneidensis (strain MR-1) GN=menD PE=3 SV=1 94 378 7.0E-07
sp|Q9CBD6|KDC_MYCLE Alpha-keto-acid decarboxylase OS=Mycobacterium leprae (strain TN) GN=kdc PE=3 SV=1 94 582 7.0E-07
sp|Q9FFT4|PDC2_ARATH Pyruvate decarboxylase 2 OS=Arabidopsis thaliana GN=PDC2 PE=2 SV=1 72 581 9.0E-07
sp|A6LB35|MEND_PARD8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=menD PE=3 SV=1 100 309 1.0E-06
sp|A9WB45|MEND_CHLAA 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=menD PE=3 SV=1 104 332 1.0E-06
sp|Q6D7W4|MEND_PECAS 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=menD PE=3 SV=1 84 201 2.0E-06
sp|A3CYZ9|MEND_SHEB5 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=menD PE=3 SV=1 94 388 2.0E-06
sp|A9KU65|MEND_SHEB9 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella baltica (strain OS195) GN=menD PE=3 SV=1 94 388 2.0E-06
sp|Q3B612|MEND_CHLL7 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=menD PE=3 SV=1 96 336 2.0E-06
sp|Q6FJA3|PDC1_CANGA Pyruvate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDC1 PE=3 SV=1 94 582 3.0E-06
sp|C6DBP2|MEND_PECCP 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=menD PE=3 SV=1 84 201 3.0E-06
sp|A4SS26|MEND_AERS4 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Aeromonas salmonicida (strain A449) GN=menD PE=3 SV=1 129 391 4.0E-06
sp|A6WTY4|MEND_SHEB8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella baltica (strain OS185) GN=menD PE=3 SV=1 94 388 4.0E-06
sp|A1SBA6|MEND_SHEAM 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=menD PE=3 SV=1 94 208 5.0E-06
sp|Q87R69|MEND_VIBPA 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=menD PE=3 SV=1 85 208 5.0E-06
sp|Q0HPY8|MEND_SHESR 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella sp. (strain MR-7) GN=menD PE=3 SV=1 94 378 6.0E-06
sp|A7MZS0|MEND_VIBCB 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=menD PE=3 SV=1 84 208 6.0E-06
sp|P51846|PDC2_TOBAC Pyruvate decarboxylase 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1 101 380 6.0E-06
sp|A7MHU4|MEND_CROS8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=menD PE=3 SV=1 84 201 6.0E-06
sp|A0KFN8|MEND_AERHH 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=menD PE=3 SV=1 96 244 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0000287 magnesium ion binding Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0019842 vitamin binding No
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901681 sulfur compound binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0050997 quaternary ammonium group binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1711 0.1288 0.125 0.0925 0.9591 0.1201 0.0344 0.0318 0.0672 0.0185

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1958
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1806
Ophiocordyceps australis map64 (Brazil) OphauB2|3423
Ophiocordyceps camponoti-floridani Ophcf2|04684
Ophiocordyceps camponoti-rufipedis Ophun1|6431
Ophiocordyceps kimflemingae Ophio5|5188
Ophiocordyceps subramaniannii Hirsu2|2118 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2118
MLRNRHATKAFRALGNARPFTSTTQSPASRAAKKAPAAQRRQTTAAAATSAAPQVRPVPSPAFNAQEQDRSHVQP
LANAEKSEMDESFIGKSGGEIFHEMMLRQGVKHIFGYAGGAILPVFDAIYNSKHFDFIMPRHEQGAGHMAEGYAR
ASGKPGVVLVTSGPGATNVITPIQDALSDGTPLVVFCGQVPTSAIGSDAFQEADVVGISRACTKWNVMVKNIAEL
PRRINEAFEIATSGRPGPVLVDLPKDVTAGILRRAIPTETALPSLPSAASQAAMELSRRQLDASLARVADLVNGA
RQPVIYAGQGVVLSPGGPELLKQLADKASIPVTTTLLGLGAFDELDGKALHMLGMHGTAYANMAMQEADLIIALG
GRFDDRVTGNIAKFAPGAKAAAAEGRGGIVHFEVMPKNINKVVQATEAVEGDVAANLRGLLPRVRPRAMADRAAW
FGKIDEWKRRWPLSHYERAGPGGLIKPQSLIEELSRLTADRKQSTYISTGVGQHQMWAAQHFRWRHPRTMITSGG
LGTMGFGLPAAIGAKVARPDALVVDIDGDASFNMTMTELATAAQFDIGVKVIVLNNEEQGMVTQWQNLFYEDRYA
HTHQVNPDFMKLAESMRVACRRVTDPADVADSLRWLIDTDGPALLEAVTDKKVPVLPMVPAGSALHEFLVYDEET
DKKRRELMRQRTCGRHG*
Coding >Hirsu2|2118
ATGCTCCGAAATCGACACGCCACCAAGGCCTTCCGGGCCCTCGGCAACGCCAGGCCCTTCACCTCGACCACCCAG
TCGCCCGCCTCCCGAGCAGCCAAGAAGGCCCCGGCCGCACAGAGGCGTCAAACAACGGCCGCTGCCGCCACCTCG
GCCGCTCCTCAGGTCCGCCCCGTCCCGAGCCCGGCCTTCAACGCACAAGAACAAGACCGAAGCCATGTCCAGCCG
CTGGCCAACGCCGAGAAGAGCGAGATGGACGAATCCTTCATTGGCAAGTCGGGCGGAGAAATCTTTCACGAAATG
ATGCTCCGACAGGGCGTTAAGCACATCTTCGGCTATGCCGGCGGAGCCATCCTGCCCGTCTTCGACGCCATCTAC
AACTCCAAACACTTCGACTTCATCATGCCCCGCCACGAGCAAGGCGCCGGCCACATGGCCGAGGGCTACGCCAGG
GCCTCGGGCAAGCCCGGCGTCGTCCTCGTCACCTCGGGCCCCGGCGCCACCAACGTCATCACCCCGATCCAGGAC
GCCCTGTCCGACGGCACGCCGCTCGTCGTCTTCTGCGGCCAGGTCCCGACCTCGGCCATCGGCAGCGACGCCTTC
CAGGAGGCCGACGTCGTCGGCATCTCGCGCGCCTGCACCAAGTGGAACGTCATGGTCAAGAACATCGCCGAGCTG
CCGCGCCGCATCAACGAGGCCTTCGAGATCGCCACCAGCGGCCGCCCCGGCCCCGTCCTCGTCGACCTGCCCAAG
GACGTGACGGCCGGCATCCTGCGCCGCGCCATCCCGACCGAGACGGCCCTGCCGTCGCTGCCCAGCGCCGCCTCC
CAGGCCGCCATGGAGCTGAGCCGCAGGCAGCTCGACGCCTCGCTCGCCCGCGTCGCCGACCTCGTCAACGGCGCC
CGCCAGCCCGTTATCTACGCCGGCCAGGGCGTCGTCCTCTCCCCCGGCGGGCCCGAGCTGCTCAAGCAGCTGGCC
GACAAGGCCTCCATCCCCGTCACCACGACGCTGCTCGGCCTCGGCGCCTTCGACGAGCTCGACGGCAAGGCCCTG
CACATGCTCGGCATGCACGGCACCGCCTACGCCAACATGGCGATGCAGGAGGCCGACCTCATCATCGCCCTCGGC
GGCCGCTTCGACGACCGCGTCACCGGCAACATCGCCAAGTTCGCGCCCGGCGCCAAGGCCGCCGCCGCCGAGGGC
CGCGGCGGCATCGTCCACTTCGAGGTGATGCCCAAGAACATCAACAAGGTGGTGCAGGCGACGGAGGCGGTCGAG
GGCGACGTGGCGGCCAACCTGCGCGGCCTGCTGCCGCGCGTCCGGCCGCGCGCCATGGCCGACCGCGCCGCCTGG
TTCGGCAAGATCGACGAGTGGAAGCGGCGCTGGCCGCTGTCGCACTACGAGCGGGCCGGGCCCGGCGGCCTCATC
AAGCCGCAGTCGCTGATCGAGGAGCTGAGCCGGCTGACGGCGGACCGCAAGCAGTCGACGTACATCTCGACGGGC
GTGGGCCAGCACCAGATGTGGGCGGCCCAGCACTTCCGCTGGCGCCACCCGCGCACCATGATCACCTCGGGCGGC
CTCGGCACCATGGGCTTCGGCCTGCCGGCCGCCATCGGGGCCAAGGTGGCGCGCCCGGACGCGCTCGTCGTCGAC
ATCGACGGCGACGCCTCCTTCAACATGACCATGACGGAGCTGGCGACGGCGGCCCAGTTCGACATCGGCGTCAAG
GTCATCGTGCTCAACAACGAGGAGCAGGGCATGGTGACGCAGTGGCAGAACCTCTTCTACGAGGACCGCTACGCC
CACACGCACCAGGTCAACCCGGACTTCATGAAGCTGGCCGAGTCGATGCGCGTCGCCTGCCGCCGCGTGACGGAC
CCGGCCGACGTCGCCGACAGCCTGCGCTGGCTCATCGACACGGACGGGCCGGCCCTGCTGGAGGCGGTGACGGAC
AAGAAGGTGCCGGTGCTGCCCATGGTGCCGGCCGGCTCGGCGCTGCACGAGTTCTTGGTGTACGACGAGGAAACG
GACAAGAAGCGGCGCGAGCTGATGCGGCAGAGGACGTGCGGCCGGCACGGGTGA
Transcript >Hirsu2|2118
ATGCTCCGAAATCGACACGCCACCAAGGCCTTCCGGGCCCTCGGCAACGCCAGGCCCTTCACCTCGACCACCCAG
TCGCCCGCCTCCCGAGCAGCCAAGAAGGCCCCGGCCGCACAGAGGCGTCAAACAACGGCCGCTGCCGCCACCTCG
GCCGCTCCTCAGGTCCGCCCCGTCCCGAGCCCGGCCTTCAACGCACAAGAACAAGACCGAAGCCATGTCCAGCCG
CTGGCCAACGCCGAGAAGAGCGAGATGGACGAATCCTTCATTGGCAAGTCGGGCGGAGAAATCTTTCACGAAATG
ATGCTCCGACAGGGCGTTAAGCACATCTTCGGCTATGCCGGCGGAGCCATCCTGCCCGTCTTCGACGCCATCTAC
AACTCCAAACACTTCGACTTCATCATGCCCCGCCACGAGCAAGGCGCCGGCCACATGGCCGAGGGCTACGCCAGG
GCCTCGGGCAAGCCCGGCGTCGTCCTCGTCACCTCGGGCCCCGGCGCCACCAACGTCATCACCCCGATCCAGGAC
GCCCTGTCCGACGGCACGCCGCTCGTCGTCTTCTGCGGCCAGGTCCCGACCTCGGCCATCGGCAGCGACGCCTTC
CAGGAGGCCGACGTCGTCGGCATCTCGCGCGCCTGCACCAAGTGGAACGTCATGGTCAAGAACATCGCCGAGCTG
CCGCGCCGCATCAACGAGGCCTTCGAGATCGCCACCAGCGGCCGCCCCGGCCCCGTCCTCGTCGACCTGCCCAAG
GACGTGACGGCCGGCATCCTGCGCCGCGCCATCCCGACCGAGACGGCCCTGCCGTCGCTGCCCAGCGCCGCCTCC
CAGGCCGCCATGGAGCTGAGCCGCAGGCAGCTCGACGCCTCGCTCGCCCGCGTCGCCGACCTCGTCAACGGCGCC
CGCCAGCCCGTTATCTACGCCGGCCAGGGCGTCGTCCTCTCCCCCGGCGGGCCCGAGCTGCTCAAGCAGCTGGCC
GACAAGGCCTCCATCCCCGTCACCACGACGCTGCTCGGCCTCGGCGCCTTCGACGAGCTCGACGGCAAGGCCCTG
CACATGCTCGGCATGCACGGCACCGCCTACGCCAACATGGCGATGCAGGAGGCCGACCTCATCATCGCCCTCGGC
GGCCGCTTCGACGACCGCGTCACCGGCAACATCGCCAAGTTCGCGCCCGGCGCCAAGGCCGCCGCCGCCGAGGGC
CGCGGCGGCATCGTCCACTTCGAGGTGATGCCCAAGAACATCAACAAGGTGGTGCAGGCGACGGAGGCGGTCGAG
GGCGACGTGGCGGCCAACCTGCGCGGCCTGCTGCCGCGCGTCCGGCCGCGCGCCATGGCCGACCGCGCCGCCTGG
TTCGGCAAGATCGACGAGTGGAAGCGGCGCTGGCCGCTGTCGCACTACGAGCGGGCCGGGCCCGGCGGCCTCATC
AAGCCGCAGTCGCTGATCGAGGAGCTGAGCCGGCTGACGGCGGACCGCAAGCAGTCGACGTACATCTCGACGGGC
GTGGGCCAGCACCAGATGTGGGCGGCCCAGCACTTCCGCTGGCGCCACCCGCGCACCATGATCACCTCGGGCGGC
CTCGGCACCATGGGCTTCGGCCTGCCGGCCGCCATCGGGGCCAAGGTGGCGCGCCCGGACGCGCTCGTCGTCGAC
ATCGACGGCGACGCCTCCTTCAACATGACCATGACGGAGCTGGCGACGGCGGCCCAGTTCGACATCGGCGTCAAG
GTCATCGTGCTCAACAACGAGGAGCAGGGCATGGTGACGCAGTGGCAGAACCTCTTCTACGAGGACCGCTACGCC
CACACGCACCAGGTCAACCCGGACTTCATGAAGCTGGCCGAGTCGATGCGCGTCGCCTGCCGCCGCGTGACGGAC
CCGGCCGACGTCGCCGACAGCCTGCGCTGGCTCATCGACACGGACGGGCCGGCCCTGCTGGAGGCGGTGACGGAC
AAGAAGGTGCCGGTGCTGCCCATGGTGCCGGCCGGCTCGGCGCTGCACGAGTTCTTGGTGTACGACGAGGAAACG
GACAAGAAGCGGCGCGAGCTGATGCGGCAGAGGACGTGCGGCCGGCACGGGTGA
Gene >Hirsu2|2118
ATGCTCCGAAATCGACACGCCACCAAGGCCTTCCGGGCCCTCGGCAACGCCAGGCCCTTCACCTCGACCACCCAG
TCGCCCGCCTCCCGAGCAGCCAAGAAGGCCCCGGCCGCACAGAGGCGTCAAACAACGGCCGCTGCCGCCACCTCG
GCCGCTCCGTAAGTCGGCCTTGGCCTCCGCCCCCTTTTACCTGCCCGCCCCGGCATCGGCACCTCGTTGAGGGGT
CAGGCCAAGAAAAGAAGACCGCAGGGAGGGAGGAAGAACATACGAGTACAAGGCGGAAGAGGATGCGGGACGCAG
AGAATCAACCGACAGTCCCACGATACCGCTCCTCCGTACCCTCGCAAGCTGACGGCCCAACCCACAGTCAGGTCC
GCCCCGTCCCGAGCCCGGCCTTCAACGCACAAGAACAAGACCGAAGCCATGTCCAGCCGCTGGCCAACGCCGAGA
AGAGCGAGATGGACGAATCGTACGCCTCCCCCGTCCCCGATGCTCGACCACCTGCTTGTGTCTGACCATGTCCCA
GCTTCATTGGCAAGTCGGGCGGAGAAATCTTTCACGAAATGATGCTCCGACAGGGCGTTAAGCACATCTGTCAGT
CGACCACTCCCTTTTCACTCTTTCTCGGCACGCCAACCCAGCTGACATTTTCCTCAGTCGGCTATGCCGGCGGAG
CCATCCTGCCCGTCTTCGACGCCATCTACAACTCCAAACACTTCGACTTCATCATGCCCCGCCACGAGCAAGGCG
CCGGCCACATGGCCGAGGGCTACGCCAGGGCCTCGGGCAAGCCCGGCGTCGTCCTCGTCACCTCGGGCCCCGGCG
CCACCAACGTCATCACCCCGATCCAGGACGCCCTGTCCGACGGCACGCCGCTCGTCGTCTTCTGCGGCCAGGTCC
CGACCTCGGCCATCGGCAGCGACGCCTTCCAGGAGGCCGACGTCGTCGGCATCTCGCGCGCCTGCACCAAGTGGA
ACGTCATGGTCAAGAACATCGCCGAGCTGCCGCGCCGCATCAACGAGGCCTTCGAGATCGCCACCAGCGGCCGCC
CCGGCCCCGTCCTCGTCGACCTGCCCAAGGACGTGACGGCCGGCATCCTGCGCCGCGCCATCCCGACCGAGACGG
CCCTGCCGTCGCTGCCCAGCGCCGCCTCCCAGGCCGCCATGGAGCTGAGCCGCAGGCAGCTCGACGCCTCGCTCG
CCCGCGTCGCCGACCTCGTCAACGGCGCCCGCCAGCCCGTTATCTACGCCGGCCAGGGCGTCGTCCTCTCCCCCG
GCGGGCCCGAGCTGCTCAAGCAGCTGGCCGACAAGGCCTCCATCCCCGTCACCACGACGCTGCTCGGCCTCGGCG
CCTTCGACGAGCTCGACGGCAAGGCCCTGCACATGCTCGGCATGCACGGCACCGCCTACGCCAACATGGCGATGC
AGGAGGCCGACCTCATCATCGCCCTCGGCGGCCGCTTCGACGACCGCGTCACCGGCAACATCGCCAAGTTCGCGC
CCGGCGCCAAGGCCGCCGCCGCCGAGGGCCGCGGCGGCATCGTCCACTTCGAGGTGATGCCCAAGAACATCAACA
AGGTGGTGCAGGCGACGGAGGCGGTCGAGGGCGACGTGGCGGCCAACCTGCGCGGCCTGCTGCCGCGCGTCCGGC
CGCGCGCCATGGCCGACCGCGCCGCCTGGTTCGGCAAGATCGACGAGTGGAAGCGGCGCTGGCCGCTGTCGCACT
ACGAGCGGGCCGGGCCCGGCGGCCTCATCAAGCCGCAGTCGCTGATCGAGGAGCTGAGCCGGCTGACGGCGGACC
GCAAGCAGTCGACGTACATCTCGACGGGCGTGGGCCAGCACCAGATGTGGGCGGCCCAGCACTTCCGCTGGCGCC
ACCCGCGCACCATGATCACCTCGGGCGGCCTCGGCACCATGGGCTTCGGCCTGCCGGCCGCCATCGGGGCCAAGG
TGGCGCGCCCGGACGCGCTCGTCGTCGACATCGACGGCGACGCCTCCTTCAACATGACCATGACGGAGCTGGCGA
CGGCGGCCCAGTTCGACATCGGCGTCAAGGTCATCGTGCTCAACAACGAGGAGCAGGGCATGGTGACGCAGTGGC
AGAACCTCTTCTACGAGGACCGCTACGCCCACACGCACCAGGTCAACCCGGACTTCATGAAGCTGGCCGAGTCGA
TGCGCGTCGCCTGCCGCCGCGTGACGGACCCGGCCGACGTCGCCGACAGCCTGCGCTGGCTCATCGACACGGACG
GGCCGGCCCTGCTGGAGGCGGTGACGGACAAGAAGGTGCCGGTGCTGCCCATGGTGCCGGCCGGCTCGGCGCTGC
ACGAGTTCTTGGTGTACGACGAGGGTGAGTCTTTTTTTCCCTTTCTGTCGACTCGACGAAGACGAGCGTGAGGAG
CTGACGATGGGCGGGCGCGCCCTTGTTGCAGAAACGGACAAGAAGCGGCGCGAGCTGATGCGGCAGAGGACGTGC
GGCCGGCACGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail