Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2118
Gene name
LocationContig_1494:1360..3850
Strand-
Gene length (bp)2490
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 2.7E-53 92 253
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 4.6E-47 500 646
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 2.0E-38 291 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07342|ILVB_YEAST Acetolactate synthase catalytic subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV2 PE=1 SV=1 56 691 0.0E+00
sp|P36620|ILVB_SCHPO Acetolactate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv1 PE=3 SV=2 83 672 0.0E+00
sp|Q5KPJ5|ILVB_CRYNJ Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|Q6SSJ3|ILVB_CRYNH Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 92 669 1.0E-149
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07342|ILVB_YEAST Acetolactate synthase catalytic subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV2 PE=1 SV=1 56 691 0.0E+00
sp|P36620|ILVB_SCHPO Acetolactate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ilv1 PE=3 SV=2 83 672 0.0E+00
sp|Q5KPJ5|ILVB_CRYNJ Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|Q6SSJ3|ILVB_CRYNH Acetolactate synthase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ILV2 PE=3 SV=1 55 671 0.0E+00
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 92 669 1.0E-149
sp|P27819|ILVB3_BRANA Acetolactate synthase 3, chloroplastic OS=Brassica napus PE=3 SV=1 22 669 2.0E-148
sp|P17597|ILVB_ARATH Acetolactate synthase, chloroplastic OS=Arabidopsis thaliana GN=ALS PE=1 SV=1 91 669 3.0E-148
sp|P27818|ILVB1_BRANA Acetolactate synthase 1, chloroplastic OS=Brassica napus PE=3 SV=1 22 669 8.0E-148
sp|P09342|ILVB1_TOBAC Acetolactate synthase 1, chloroplastic OS=Nicotiana tabacum GN=ALS SURA PE=1 SV=1 81 669 2.0E-145
sp|P09114|ILVB2_TOBAC Acetolactate synthase 2, chloroplastic OS=Nicotiana tabacum GN=ALS SURB PE=1 SV=1 91 669 7.0E-145
sp|Q6K2E8|ILVB1_ORYSJ Acetolactate synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS1 PE=2 SV=1 91 670 1.0E-143
sp|Q57725|ILVB_METJA Probable acetolactate synthase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvB PE=3 SV=1 92 665 1.0E-142
sp|Q9RQ65|ILVI_BUCSC Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=ilvI PE=3 SV=1 92 634 8.0E-142
sp|Q41768|ILVB1_MAIZE Acetolactate synthase 1, chloroplastic OS=Zea mays GN=ALS1 PE=3 SV=1 91 670 1.0E-141
sp|P00892|ILVG_ECOLI Acetolactate synthase isozyme 2 large subunit OS=Escherichia coli (strain K12) GN=ilvG PE=1 SV=3 104 669 2.0E-139
sp|O85293|ILVI_BUCAP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ilvI PE=3 SV=1 92 675 7.0E-139
sp|P57321|ILVI_BUCAI Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ilvI PE=3 SV=1 92 675 1.0E-138
sp|P45261|ILVI_HAEIN Acetolactate synthase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvI PE=3 SV=1 92 676 1.0E-137
sp|P0A623|ILVB_MYCBO Acetolactate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvB PE=3 SV=1 105 668 1.0E-136
sp|P9WG41|ILVB1_MYCTU Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB1 PE=1 SV=1 105 668 1.0E-136
sp|P9WG40|ILVB1_MYCTO Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvB1 PE=3 SV=1 105 668 1.0E-136
sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme 3 large subunit OS=Escherichia coli (strain K12) GN=ilvI PE=1 SV=2 92 674 5.0E-136
sp|Q1XDF6|ILVB_PYRYE Acetolactate synthase large subunit OS=Pyropia yezoensis GN=ilvB PE=3 SV=1 91 664 6.0E-136
sp|O33112|ILVB_MYCLE Acetolactate synthase OS=Mycobacterium leprae (strain TN) GN=ilvB PE=3 SV=1 106 676 7.0E-136
sp|Q41769|ILVB2_MAIZE Acetolactate synthase 2, chloroplastic OS=Zea mays GN=ALS2 PE=3 SV=1 91 670 1.0E-135
sp|Q7U5G1|ILVB_SYNPX Acetolactate synthase large subunit OS=Synechococcus sp. (strain WH8102) GN=ilvB PE=3 SV=1 92 664 2.0E-135
sp|P14874|ILVB2_BRANA Acetolactate synthase 2, chloroplastic OS=Brassica napus PE=3 SV=1 62 670 1.0E-134
sp|P08142|ILVB_ECOLI Acetolactate synthase isozyme 1 large subunit OS=Escherichia coli (strain K12) GN=ilvB PE=1 SV=1 92 669 2.0E-133
sp|P42463|ILVB_CORGL Acetolactate synthase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvB PE=3 SV=1 109 664 5.0E-133
sp|P40811|ILVI_SALTY Acetolactate synthase isozyme 3 large subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvI PE=3 SV=3 92 674 5.0E-133
sp|P69684|ILVB_PORUM Acetolactate synthase large subunit OS=Porphyra umbilicalis GN=ilvB PE=3 SV=1 84 664 7.0E-132
sp|P69683|ILVB_PORPU Acetolactate synthase large subunit OS=Porphyra purpurea GN=ilvB PE=3 SV=1 84 664 7.0E-132
sp|O78518|ILVB_GUITH Acetolactate synthase large subunit OS=Guillardia theta GN=ilvB PE=3 SV=1 101 664 1.0E-131
sp|Q02137|ILVB_LACLA Acetolactate synthase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvB PE=3 SV=2 92 662 8.0E-131
sp|Q89AP7|ILVI_BUCBP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ilvI PE=3 SV=1 92 628 4.0E-130
sp|O19929|ILVB_CYACA Acetolactate synthase large subunit OS=Cyanidium caldarium GN=ilvB PE=3 SV=1 91 669 5.0E-130
sp|Q59498|ILVB_MYCAV Acetolactate synthase OS=Mycobacterium avium GN=ilvB PE=3 SV=1 105 676 2.0E-129
sp|Q7XKQ8|ILVB2_ORYSJ Probable acetolactate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ALS2 PE=2 SV=2 91 670 2.0E-128
sp|O08353|ILVB_METAO Probable acetolactate synthase large subunit OS=Methanococcus aeolicus GN=ilvB PE=3 SV=1 92 686 4.0E-127
sp|P27868|ILVB_ARTPT Acetolactate synthase (Fragment) OS=Arthrospira platensis GN=ilvY PE=3 SV=1 103 662 2.0E-124
sp|P0AEP7|GCL_ECOLI Glyoxylate carboligase OS=Escherichia coli (strain K12) GN=gcl PE=1 SV=2 103 677 3.0E-70
sp|P0AEP8|GCL_ECO57 Glyoxylate carboligase OS=Escherichia coli O157:H7 GN=gcl PE=3 SV=2 103 677 3.0E-70
sp|Q93PS3|XSC_DESTI Sulfoacetaldehyde acetyltransferase OS=Desulfonispora thiosulfatigenes GN=xsc PE=1 SV=1 95 653 3.0E-59
sp|Q04789|ILVX_BACSU Acetolactate synthase OS=Bacillus subtilis (strain 168) GN=alsS PE=2 SV=3 86 650 2.0E-57
sp|P96591|YDAP_BACSU Putative thiamine pyrophosphate-containing protein YdaP OS=Bacillus subtilis (strain 168) GN=ydaP PE=2 SV=1 91 664 1.0E-56
sp|Q84H44|XSC_CASDE Sulfoacetaldehyde acetyltransferase OS=Castellaniella defragrans GN=xsc PE=1 SV=3 95 659 6.0E-50
sp|Q84H41|XSC_ALCXX Sulfoacetaldehyde acetyltransferase OS=Alcaligenes xylosoxydans xylosoxydans GN=xsc PE=1 SV=3 95 638 5.0E-49
sp|D5AKX8|XSC_RHOCB Sulfoacetaldehyde acetyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=xsc PE=2 SV=1 95 603 4.0E-46
sp|P27696|ILVB_KLEPN Acetolactate synthase, catabolic OS=Klebsiella pneumoniae GN=budB PE=1 SV=1 93 652 6.0E-43
sp|Q54970|POXB_STRPN Pyruvate oxidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=spxB PE=3 SV=2 105 615 9.0E-41
sp|Q04524|ILVB_RAOTE Acetolactate synthase, catabolic OS=Raoultella terrigena GN=budB PE=3 SV=1 93 652 1.0E-38
sp|P07003|POXB_ECOLI Pyruvate dehydrogenase [ubiquinone] OS=Escherichia coli (strain K12) GN=poxB PE=1 SV=1 105 657 1.0E-37
sp|Q58077|Y663_METJA Uncharacterized protein MJ0663 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0663 PE=3 SV=1 93 652 1.0E-37
sp|Q92UW6|XSC_RHIME Probable sulfoacetaldehyde acetyltransferase OS=Rhizobium meliloti (strain 1021) GN=xsc PE=3 SV=1 95 633 7.0E-37
sp|P37063|POXB_LACPL Pyruvate oxidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pox5 PE=1 SV=3 105 654 2.0E-36
sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=1 SV=1 79 581 2.0E-35
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 130 584 1.0E-32
sp|P0CH62|CHDH_AZOSP Cyclohexane-1,2-dione hydrolase OS=Azoarcus sp. PE=1 SV=1 91 651 6.0E-32
sp|O05031|Y737_HAEIN Putative uncharacterized protein HI_0737 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0737 PE=5 SV=1 92 221 4.0E-31
sp|Q6NV04|ILVBL_DANRE Acetolactate synthase-like protein OS=Danio rerio GN=ilvbl PE=2 SV=1 91 591 1.0E-28
sp|A1L0T0|ILVBL_HUMAN Acetolactate synthase-like protein OS=Homo sapiens GN=ILVBL PE=1 SV=2 91 581 2.0E-28
sp|P20906|MDLC_PSEPU Benzoylformate decarboxylase OS=Pseudomonas putida GN=mdlC PE=1 SV=2 98 653 1.0E-27
sp|Q0JMH0|HACL_ORYSJ 2-hydroxyacyl-CoA lyase OS=Oryza sativa subsp. japonica GN=Os01g0505400 PE=3 SV=3 108 581 3.0E-27
sp|Q9LCV9|CEAS_STRCL N(2)-(2-carboxyethyl)arginine synthase OS=Streptomyces clavuligerus GN=ceaS PE=1 SV=1 120 646 4.0E-27
sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 78 650 1.0E-26
sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 78 652 1.0E-26
sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 92 650 3.0E-26
sp|A6QQT9|ILVBL_BOVIN Acetolactate synthase-like protein OS=Bos taurus GN=ILVBL PE=2 SV=2 91 581 9.0E-26
sp|O61856|ILVBL_CAEEL Acetolactate synthase-like protein OS=Caenorhabditis elegans GN=T26C12.1 PE=3 SV=2 91 581 7.0E-25
sp|Q6DDK5|ILVBL_XENLA Acetolactate synthase-like protein OS=Xenopus laevis GN=ilvbl PE=2 SV=1 93 569 2.0E-24
sp|Q8Y9Y1|IOLD_LISMO 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=iolD PE=3 SV=1 88 634 5.0E-24
sp|P0AFI0|OXC_ECOLI Oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1 84 581 5.0E-24
sp|P0AFI1|OXC_ECO57 Oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1 84 581 5.0E-24
sp|Q9HUR2|MDLC_PSEAE Benzoylformate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mdlC PE=3 SV=1 98 654 1.0E-23
sp|Q92EQ4|IOLD_LISIN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=iolD PE=3 SV=1 105 634 2.0E-23
sp|Q723S8|IOLD_LISMF 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=iolD PE=3 SV=2 88 634 6.0E-23
sp|P9WG39|ILVG_MYCTU Acetolactate synthase large subunit IlvG OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvG PE=1 SV=1 94 653 7.0E-23
sp|P9WG38|ILVG_MYCTO Acetolactate synthase large subunit IlvG OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvG PE=3 SV=1 94 653 7.0E-23
sp|P66947|ILVG_MYCBO Probable acetolactate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvG PE=3 SV=1 94 653 7.0E-23
sp|Q8BU33|ILVBL_MOUSE Acetolactate synthase-like protein OS=Mus musculus GN=Ilvbl PE=1 SV=1 83 581 1.0E-22
sp|Q9KAG9|IOLD_BACHD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=iolD PE=3 SV=1 98 634 2.0E-22
sp|Q5WKY8|IOLD_BACSK 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus clausii (strain KSM-K16) GN=iolD PE=3 SV=1 104 614 3.0E-22
sp|A5YBJ6|IOLD_LACCA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Lactobacillus casei GN=iolD PE=3 SV=2 104 625 3.0E-22
sp|Q4V1F5|IOLD2_BACCZ 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 2 OS=Bacillus cereus (strain ZK / E33L) GN=iolD2 PE=3 SV=1 104 634 2.0E-21
sp|Q5KYR0|IOLD_GEOKA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Geobacillus kaustophilus (strain HTA426) GN=iolD PE=3 SV=1 98 591 8.0E-21
sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 93 581 2.0E-20
sp|B7JPM3|IOLD_BACC0 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus cereus (strain AH820) GN=iolD PE=3 SV=1 104 591 2.0E-20
sp|P42415|IOLD_BACSU 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus subtilis (strain 168) GN=iolD PE=1 SV=2 104 646 3.0E-20
sp|Q0TUZ2|IOLD_CLOP1 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=iolD PE=3 SV=1 84 591 6.0E-20
sp|Q9HUI8|ARUI_PSEAE Probable 2-ketoarginine decarboxylase AruI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruI PE=1 SV=1 92 254 6.0E-20
sp|A7ZAH8|IOLD_BACMF 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolD PE=3 SV=1 104 646 5.0E-19
sp|Q65D03|IOLD_BACLD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=iolD PE=3 SV=1 104 614 7.0E-19
sp|B2V4K0|IOLD_CLOBA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=iolD PE=3 SV=1 84 614 9.0E-19
sp|C1EVJ3|IOLD_BACC3 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus cereus (strain 03BB102) GN=iolD PE=3 SV=1 104 591 2.0E-18
sp|A0REB6|IOLD_BACAH 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus thuringiensis (strain Al Hakam) GN=iolD PE=3 SV=1 104 591 2.0E-18
sp|A4IPB6|IOLD_GEOTN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolD PE=3 SV=1 104 591 7.0E-18
sp|P10343|YI42_PSEAY Uncharacterized 42.6 kDa protein in isoamylase 3'region OS=Pseudomonas amyloderamosa PE=4 SV=1 95 520 2.0E-17
sp|P39994|YEC0_YEAST Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL020C PE=1 SV=1 97 581 1.0E-16
sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 132 331 3.0E-16
sp|Q9P7P6|PDC3_SCHPO Probable pyruvate decarboxylase C186.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.09 PE=3 SV=1 101 651 3.0E-16
sp|Q9Y7M1|YGK4_SCHPO Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.04 PE=3 SV=1 92 582 4.0E-16
sp|P51853|BZNB_PSEFL Benzaldehyde lyase OS=Pseudomonas fluorescens GN=bznB PE=1 SV=1 92 593 8.0E-14
sp|Q81QB5|IOLD_BACAN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus anthracis GN=iolD PE=3 SV=1 104 389 3.0E-13
sp|C3LHY1|IOLD_BACAC 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=iolD PE=3 SV=1 104 389 3.0E-13
sp|C3PAZ3|IOLD_BACAA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus anthracis (strain A0248) GN=iolD PE=3 SV=1 104 389 3.0E-13
sp|Q6HIK2|IOLD_BACHK 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=iolD PE=3 SV=1 104 389 4.0E-13
sp|Q63B73|IOLD1_BACCZ 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 1 OS=Bacillus cereus (strain ZK / E33L) GN=iolD1 PE=3 SV=1 104 389 5.0E-13
sp|P23234|DCIP_ENTCL Indole-3-pyruvate decarboxylase OS=Enterobacter cloacae GN=ipdC PE=1 SV=1 105 651 9.0E-13
sp|Q09737|PDC1_SCHPO Putative pyruvate decarboxylase C13A11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13A11.06 PE=3 SV=2 94 629 6.0E-11
sp|P9WG37|KDC_MYCTU Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdc PE=1 SV=1 94 582 6.0E-11
sp|A5U0P1|KDC_MYCTA Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kdc PE=3 SV=1 94 582 6.0E-11
sp|A1KGY5|KDC_MYCBP Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kdc PE=3 SV=1 94 582 6.0E-11
sp|Q7U140|KDC_MYCBO Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdc PE=3 SV=1 94 582 6.0E-11
sp|A1BI74|MEND_CHLPD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=menD PE=3 SV=1 99 615 1.0E-10
sp|P9WG36|KDC_MYCTO Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdc PE=3 SV=1 94 582 2.0E-10
sp|P83779|PDC1_CANAL Pyruvate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PDC11 PE=1 SV=2 94 582 9.0E-10
sp|Q898E8|IOLD_CLOTE 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Clostridium tetani (strain Massachusetts / E88) GN=iolD PE=3 SV=2 98 383 3.0E-09
sp|B3QL00|MEND_CHLP8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=menD PE=3 SV=1 84 249 3.0E-09
sp|P34734|PDC_HANUV Pyruvate decarboxylase OS=Hanseniaspora uvarum GN=PDC PE=3 SV=1 94 387 4.0E-09
sp|A0PL16|KDC_MYCUA Alpha-keto-acid decarboxylase OS=Mycobacterium ulcerans (strain Agy99) GN=kdc PE=3 SV=1 94 582 5.0E-09
sp|Q9M039|PDC3_ARATH Pyruvate decarboxylase 3 OS=Arabidopsis thaliana GN=PDC3 PE=2 SV=1 101 581 7.0E-09
sp|P16467|PDC5_YEAST Pyruvate decarboxylase isozyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC5 PE=1 SV=4 94 581 3.0E-08
sp|Q9M040|PDC4_ARATH Pyruvate decarboxylase 4 OS=Arabidopsis thaliana GN=PDC4 PE=2 SV=1 101 581 4.0E-08
sp|B3EG68|MEND_CHLL2 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=menD PE=3 SV=1 138 249 5.0E-08
sp|B4SET5|MEND_PELPB 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=menD PE=3 SV=1 84 334 8.0E-08
sp|Q2LXE3|MEND_SYNAS 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Syntrophus aciditrophicus (strain SB) GN=menD PE=3 SV=2 101 212 2.0E-07
sp|A4SD60|MEND_CHLPM 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=menD PE=3 SV=1 99 332 3.0E-07
sp|P06169|PDC1_YEAST Pyruvate decarboxylase isozyme 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC1 PE=1 SV=7 94 582 4.0E-07
sp|Q8KBE8|MEND_CHLTE 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=menD PE=3 SV=2 99 249 5.0E-07
sp|Q8E8T4|MEND_SHEON 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella oneidensis (strain MR-1) GN=menD PE=3 SV=1 94 378 7.0E-07
sp|Q9CBD6|KDC_MYCLE Alpha-keto-acid decarboxylase OS=Mycobacterium leprae (strain TN) GN=kdc PE=3 SV=1 94 582 7.0E-07
sp|Q9FFT4|PDC2_ARATH Pyruvate decarboxylase 2 OS=Arabidopsis thaliana GN=PDC2 PE=2 SV=1 72 581 9.0E-07
sp|A6LB35|MEND_PARD8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=menD PE=3 SV=1 100 309 1.0E-06
sp|A9WB45|MEND_CHLAA 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=menD PE=3 SV=1 104 332 1.0E-06
sp|Q6D7W4|MEND_PECAS 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=menD PE=3 SV=1 84 201 2.0E-06
sp|A3CYZ9|MEND_SHEB5 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=menD PE=3 SV=1 94 388 2.0E-06
sp|A9KU65|MEND_SHEB9 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella baltica (strain OS195) GN=menD PE=3 SV=1 94 388 2.0E-06
sp|Q3B612|MEND_CHLL7 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=menD PE=3 SV=1 96 336 2.0E-06
sp|Q6FJA3|PDC1_CANGA Pyruvate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDC1 PE=3 SV=1 94 582 3.0E-06
sp|C6DBP2|MEND_PECCP 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=menD PE=3 SV=1 84 201 3.0E-06
sp|A4SS26|MEND_AERS4 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Aeromonas salmonicida (strain A449) GN=menD PE=3 SV=1 129 391 4.0E-06
sp|A6WTY4|MEND_SHEB8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella baltica (strain OS185) GN=menD PE=3 SV=1 94 388 4.0E-06
sp|A1SBA6|MEND_SHEAM 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=menD PE=3 SV=1 94 208 5.0E-06
sp|Q87R69|MEND_VIBPA 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=menD PE=3 SV=1 85 208 5.0E-06
sp|Q0HPY8|MEND_SHESR 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Shewanella sp. (strain MR-7) GN=menD PE=3 SV=1 94 378 6.0E-06
sp|A7MZS0|MEND_VIBCB 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=menD PE=3 SV=1 84 208 6.0E-06
sp|P51846|PDC2_TOBAC Pyruvate decarboxylase 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1 101 380 6.0E-06
sp|A7MHU4|MEND_CROS8 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=menD PE=3 SV=1 84 201 6.0E-06
sp|A0KFN8|MEND_AERHH 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=menD PE=3 SV=1 96 244 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0050662 coenzyme binding No
GO:0046872 metal ion binding No
GO:1901681 sulfur compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2118
MLRNRHATKAFRALGNARPFTSTTQSPASRAAKKAPAAQRRQTTAAAATSAAPQVRPVPSPAFNAQEQDRSHVQP
LANAEKSEMDESFIGKSGGEIFHEMMLRQGVKHIFGYAGGAILPVFDAIYNSKHFDFIMPRHEQGAGHMAEGYAR
ASGKPGVVLVTSGPGATNVITPIQDALSDGTPLVVFCGQVPTSAIGSDAFQEADVVGISRACTKWNVMVKNIAEL
PRRINEAFEIATSGRPGPVLVDLPKDVTAGILRRAIPTETALPSLPSAASQAAMELSRRQLDASLARVADLVNGA
RQPVIYAGQGVVLSPGGPELLKQLADKASIPVTTTLLGLGAFDELDGKALHMLGMHGTAYANMAMQEADLIIALG
GRFDDRVTGNIAKFAPGAKAAAAEGRGGIVHFEVMPKNINKVVQATEAVEGDVAANLRGLLPRVRPRAMADRAAW
FGKIDEWKRRWPLSHYERAGPGGLIKPQSLIEELSRLTADRKQSTYISTGVGQHQMWAAQHFRWRHPRTMITSGG
LGTMGFGLPAAIGAKVARPDALVVDIDGDASFNMTMTELATAAQFDIGVKVIVLNNEEQGMVTQWQNLFYEDRYA
HTHQVNPDFMKLAESMRVACRRVTDPADVADSLRWLIDTDGPALLEAVTDKKVPVLPMVPAGSALHEFLVYDEET
DKKRRELMRQRTCGRHG*
Coding >Hirsu2|2118
ATGCTCCGAAATCGACACGCCACCAAGGCCTTCCGGGCCCTCGGCAACGCCAGGCCCTTCACCTCGACCACCCAG
TCGCCCGCCTCCCGAGCAGCCAAGAAGGCCCCGGCCGCACAGAGGCGTCAAACAACGGCCGCTGCCGCCACCTCG
GCCGCTCCTCAGGTCCGCCCCGTCCCGAGCCCGGCCTTCAACGCACAAGAACAAGACCGAAGCCATGTCCAGCCG
CTGGCCAACGCCGAGAAGAGCGAGATGGACGAATCCTTCATTGGCAAGTCGGGCGGAGAAATCTTTCACGAAATG
ATGCTCCGACAGGGCGTTAAGCACATCTTCGGCTATGCCGGCGGAGCCATCCTGCCCGTCTTCGACGCCATCTAC
AACTCCAAACACTTCGACTTCATCATGCCCCGCCACGAGCAAGGCGCCGGCCACATGGCCGAGGGCTACGCCAGG
GCCTCGGGCAAGCCCGGCGTCGTCCTCGTCACCTCGGGCCCCGGCGCCACCAACGTCATCACCCCGATCCAGGAC
GCCCTGTCCGACGGCACGCCGCTCGTCGTCTTCTGCGGCCAGGTCCCGACCTCGGCCATCGGCAGCGACGCCTTC
CAGGAGGCCGACGTCGTCGGCATCTCGCGCGCCTGCACCAAGTGGAACGTCATGGTCAAGAACATCGCCGAGCTG
CCGCGCCGCATCAACGAGGCCTTCGAGATCGCCACCAGCGGCCGCCCCGGCCCCGTCCTCGTCGACCTGCCCAAG
GACGTGACGGCCGGCATCCTGCGCCGCGCCATCCCGACCGAGACGGCCCTGCCGTCGCTGCCCAGCGCCGCCTCC
CAGGCCGCCATGGAGCTGAGCCGCAGGCAGCTCGACGCCTCGCTCGCCCGCGTCGCCGACCTCGTCAACGGCGCC
CGCCAGCCCGTTATCTACGCCGGCCAGGGCGTCGTCCTCTCCCCCGGCGGGCCCGAGCTGCTCAAGCAGCTGGCC
GACAAGGCCTCCATCCCCGTCACCACGACGCTGCTCGGCCTCGGCGCCTTCGACGAGCTCGACGGCAAGGCCCTG
CACATGCTCGGCATGCACGGCACCGCCTACGCCAACATGGCGATGCAGGAGGCCGACCTCATCATCGCCCTCGGC
GGCCGCTTCGACGACCGCGTCACCGGCAACATCGCCAAGTTCGCGCCCGGCGCCAAGGCCGCCGCCGCCGAGGGC
CGCGGCGGCATCGTCCACTTCGAGGTGATGCCCAAGAACATCAACAAGGTGGTGCAGGCGACGGAGGCGGTCGAG
GGCGACGTGGCGGCCAACCTGCGCGGCCTGCTGCCGCGCGTCCGGCCGCGCGCCATGGCCGACCGCGCCGCCTGG
TTCGGCAAGATCGACGAGTGGAAGCGGCGCTGGCCGCTGTCGCACTACGAGCGGGCCGGGCCCGGCGGCCTCATC
AAGCCGCAGTCGCTGATCGAGGAGCTGAGCCGGCTGACGGCGGACCGCAAGCAGTCGACGTACATCTCGACGGGC
GTGGGCCAGCACCAGATGTGGGCGGCCCAGCACTTCCGCTGGCGCCACCCGCGCACCATGATCACCTCGGGCGGC
CTCGGCACCATGGGCTTCGGCCTGCCGGCCGCCATCGGGGCCAAGGTGGCGCGCCCGGACGCGCTCGTCGTCGAC
ATCGACGGCGACGCCTCCTTCAACATGACCATGACGGAGCTGGCGACGGCGGCCCAGTTCGACATCGGCGTCAAG
GTCATCGTGCTCAACAACGAGGAGCAGGGCATGGTGACGCAGTGGCAGAACCTCTTCTACGAGGACCGCTACGCC
CACACGCACCAGGTCAACCCGGACTTCATGAAGCTGGCCGAGTCGATGCGCGTCGCCTGCCGCCGCGTGACGGAC
CCGGCCGACGTCGCCGACAGCCTGCGCTGGCTCATCGACACGGACGGGCCGGCCCTGCTGGAGGCGGTGACGGAC
AAGAAGGTGCCGGTGCTGCCCATGGTGCCGGCCGGCTCGGCGCTGCACGAGTTCTTGGTGTACGACGAGGAAACG
GACAAGAAGCGGCGCGAGCTGATGCGGCAGAGGACGTGCGGCCGGCACGGGTGA
Transcript >Hirsu2|2118
ATGCTCCGAAATCGACACGCCACCAAGGCCTTCCGGGCCCTCGGCAACGCCAGGCCCTTCACCTCGACCACCCAG
TCGCCCGCCTCCCGAGCAGCCAAGAAGGCCCCGGCCGCACAGAGGCGTCAAACAACGGCCGCTGCCGCCACCTCG
GCCGCTCCTCAGGTCCGCCCCGTCCCGAGCCCGGCCTTCAACGCACAAGAACAAGACCGAAGCCATGTCCAGCCG
CTGGCCAACGCCGAGAAGAGCGAGATGGACGAATCCTTCATTGGCAAGTCGGGCGGAGAAATCTTTCACGAAATG
ATGCTCCGACAGGGCGTTAAGCACATCTTCGGCTATGCCGGCGGAGCCATCCTGCCCGTCTTCGACGCCATCTAC
AACTCCAAACACTTCGACTTCATCATGCCCCGCCACGAGCAAGGCGCCGGCCACATGGCCGAGGGCTACGCCAGG
GCCTCGGGCAAGCCCGGCGTCGTCCTCGTCACCTCGGGCCCCGGCGCCACCAACGTCATCACCCCGATCCAGGAC
GCCCTGTCCGACGGCACGCCGCTCGTCGTCTTCTGCGGCCAGGTCCCGACCTCGGCCATCGGCAGCGACGCCTTC
CAGGAGGCCGACGTCGTCGGCATCTCGCGCGCCTGCACCAAGTGGAACGTCATGGTCAAGAACATCGCCGAGCTG
CCGCGCCGCATCAACGAGGCCTTCGAGATCGCCACCAGCGGCCGCCCCGGCCCCGTCCTCGTCGACCTGCCCAAG
GACGTGACGGCCGGCATCCTGCGCCGCGCCATCCCGACCGAGACGGCCCTGCCGTCGCTGCCCAGCGCCGCCTCC
CAGGCCGCCATGGAGCTGAGCCGCAGGCAGCTCGACGCCTCGCTCGCCCGCGTCGCCGACCTCGTCAACGGCGCC
CGCCAGCCCGTTATCTACGCCGGCCAGGGCGTCGTCCTCTCCCCCGGCGGGCCCGAGCTGCTCAAGCAGCTGGCC
GACAAGGCCTCCATCCCCGTCACCACGACGCTGCTCGGCCTCGGCGCCTTCGACGAGCTCGACGGCAAGGCCCTG
CACATGCTCGGCATGCACGGCACCGCCTACGCCAACATGGCGATGCAGGAGGCCGACCTCATCATCGCCCTCGGC
GGCCGCTTCGACGACCGCGTCACCGGCAACATCGCCAAGTTCGCGCCCGGCGCCAAGGCCGCCGCCGCCGAGGGC
CGCGGCGGCATCGTCCACTTCGAGGTGATGCCCAAGAACATCAACAAGGTGGTGCAGGCGACGGAGGCGGTCGAG
GGCGACGTGGCGGCCAACCTGCGCGGCCTGCTGCCGCGCGTCCGGCCGCGCGCCATGGCCGACCGCGCCGCCTGG
TTCGGCAAGATCGACGAGTGGAAGCGGCGCTGGCCGCTGTCGCACTACGAGCGGGCCGGGCCCGGCGGCCTCATC
AAGCCGCAGTCGCTGATCGAGGAGCTGAGCCGGCTGACGGCGGACCGCAAGCAGTCGACGTACATCTCGACGGGC
GTGGGCCAGCACCAGATGTGGGCGGCCCAGCACTTCCGCTGGCGCCACCCGCGCACCATGATCACCTCGGGCGGC
CTCGGCACCATGGGCTTCGGCCTGCCGGCCGCCATCGGGGCCAAGGTGGCGCGCCCGGACGCGCTCGTCGTCGAC
ATCGACGGCGACGCCTCCTTCAACATGACCATGACGGAGCTGGCGACGGCGGCCCAGTTCGACATCGGCGTCAAG
GTCATCGTGCTCAACAACGAGGAGCAGGGCATGGTGACGCAGTGGCAGAACCTCTTCTACGAGGACCGCTACGCC
CACACGCACCAGGTCAACCCGGACTTCATGAAGCTGGCCGAGTCGATGCGCGTCGCCTGCCGCCGCGTGACGGAC
CCGGCCGACGTCGCCGACAGCCTGCGCTGGCTCATCGACACGGACGGGCCGGCCCTGCTGGAGGCGGTGACGGAC
AAGAAGGTGCCGGTGCTGCCCATGGTGCCGGCCGGCTCGGCGCTGCACGAGTTCTTGGTGTACGACGAGGAAACG
GACAAGAAGCGGCGCGAGCTGATGCGGCAGAGGACGTGCGGCCGGCACGGGTGA
Gene >Hirsu2|2118
ATGCTCCGAAATCGACACGCCACCAAGGCCTTCCGGGCCCTCGGCAACGCCAGGCCCTTCACCTCGACCACCCAG
TCGCCCGCCTCCCGAGCAGCCAAGAAGGCCCCGGCCGCACAGAGGCGTCAAACAACGGCCGCTGCCGCCACCTCG
GCCGCTCCGTAAGTCGGCCTTGGCCTCCGCCCCCTTTTACCTGCCCGCCCCGGCATCGGCACCTCGTTGAGGGGT
CAGGCCAAGAAAAGAAGACCGCAGGGAGGGAGGAAGAACATACGAGTACAAGGCGGAAGAGGATGCGGGACGCAG
AGAATCAACCGACAGTCCCACGATACCGCTCCTCCGTACCCTCGCAAGCTGACGGCCCAACCCACAGTCAGGTCC
GCCCCGTCCCGAGCCCGGCCTTCAACGCACAAGAACAAGACCGAAGCCATGTCCAGCCGCTGGCCAACGCCGAGA
AGAGCGAGATGGACGAATCGTACGCCTCCCCCGTCCCCGATGCTCGACCACCTGCTTGTGTCTGACCATGTCCCA
GCTTCATTGGCAAGTCGGGCGGAGAAATCTTTCACGAAATGATGCTCCGACAGGGCGTTAAGCACATCTGTCAGT
CGACCACTCCCTTTTCACTCTTTCTCGGCACGCCAACCCAGCTGACATTTTCCTCAGTCGGCTATGCCGGCGGAG
CCATCCTGCCCGTCTTCGACGCCATCTACAACTCCAAACACTTCGACTTCATCATGCCCCGCCACGAGCAAGGCG
CCGGCCACATGGCCGAGGGCTACGCCAGGGCCTCGGGCAAGCCCGGCGTCGTCCTCGTCACCTCGGGCCCCGGCG
CCACCAACGTCATCACCCCGATCCAGGACGCCCTGTCCGACGGCACGCCGCTCGTCGTCTTCTGCGGCCAGGTCC
CGACCTCGGCCATCGGCAGCGACGCCTTCCAGGAGGCCGACGTCGTCGGCATCTCGCGCGCCTGCACCAAGTGGA
ACGTCATGGTCAAGAACATCGCCGAGCTGCCGCGCCGCATCAACGAGGCCTTCGAGATCGCCACCAGCGGCCGCC
CCGGCCCCGTCCTCGTCGACCTGCCCAAGGACGTGACGGCCGGCATCCTGCGCCGCGCCATCCCGACCGAGACGG
CCCTGCCGTCGCTGCCCAGCGCCGCCTCCCAGGCCGCCATGGAGCTGAGCCGCAGGCAGCTCGACGCCTCGCTCG
CCCGCGTCGCCGACCTCGTCAACGGCGCCCGCCAGCCCGTTATCTACGCCGGCCAGGGCGTCGTCCTCTCCCCCG
GCGGGCCCGAGCTGCTCAAGCAGCTGGCCGACAAGGCCTCCATCCCCGTCACCACGACGCTGCTCGGCCTCGGCG
CCTTCGACGAGCTCGACGGCAAGGCCCTGCACATGCTCGGCATGCACGGCACCGCCTACGCCAACATGGCGATGC
AGGAGGCCGACCTCATCATCGCCCTCGGCGGCCGCTTCGACGACCGCGTCACCGGCAACATCGCCAAGTTCGCGC
CCGGCGCCAAGGCCGCCGCCGCCGAGGGCCGCGGCGGCATCGTCCACTTCGAGGTGATGCCCAAGAACATCAACA
AGGTGGTGCAGGCGACGGAGGCGGTCGAGGGCGACGTGGCGGCCAACCTGCGCGGCCTGCTGCCGCGCGTCCGGC
CGCGCGCCATGGCCGACCGCGCCGCCTGGTTCGGCAAGATCGACGAGTGGAAGCGGCGCTGGCCGCTGTCGCACT
ACGAGCGGGCCGGGCCCGGCGGCCTCATCAAGCCGCAGTCGCTGATCGAGGAGCTGAGCCGGCTGACGGCGGACC
GCAAGCAGTCGACGTACATCTCGACGGGCGTGGGCCAGCACCAGATGTGGGCGGCCCAGCACTTCCGCTGGCGCC
ACCCGCGCACCATGATCACCTCGGGCGGCCTCGGCACCATGGGCTTCGGCCTGCCGGCCGCCATCGGGGCCAAGG
TGGCGCGCCCGGACGCGCTCGTCGTCGACATCGACGGCGACGCCTCCTTCAACATGACCATGACGGAGCTGGCGA
CGGCGGCCCAGTTCGACATCGGCGTCAAGGTCATCGTGCTCAACAACGAGGAGCAGGGCATGGTGACGCAGTGGC
AGAACCTCTTCTACGAGGACCGCTACGCCCACACGCACCAGGTCAACCCGGACTTCATGAAGCTGGCCGAGTCGA
TGCGCGTCGCCTGCCGCCGCGTGACGGACCCGGCCGACGTCGCCGACAGCCTGCGCTGGCTCATCGACACGGACG
GGCCGGCCCTGCTGGAGGCGGTGACGGACAAGAAGGTGCCGGTGCTGCCCATGGTGCCGGCCGGCTCGGCGCTGC
ACGAGTTCTTGGTGTACGACGAGGGTGAGTCTTTTTTTCCCTTTCTGTCGACTCGACGAAGACGAGCGTGAGGAG
CTGACGATGGGCGGGCGCGCCCTTGTTGCAGAAACGGACAAGAAGCGGCGCGAGCTGATGCGGCAGAGGACGTGC
GGCCGGCACGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail