Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2112
Gene name
LocationContig_1492:1755..3546
Strand+
Gene length (bp)1791
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 4.5E-23 411 557

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53259|PCP1_YEAST Rhomboid protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCP1 PE=1 SV=1 337 569 4.0E-15
sp|Q58EK4|PARL_DANRE Presenilins-associated rhomboid-like protein, mitochondrial OS=Danio rerio GN=parl PE=2 SV=1 369 561 6.0E-15
sp|Q3B8P0|PARL_RAT Presenilins-associated rhomboid-like protein, mitochondrial OS=Rattus norvegicus GN=Parl PE=2 SV=1 364 561 3.0E-12
sp|Q5XJY4|PARL_MOUSE Presenilins-associated rhomboid-like protein, mitochondrial OS=Mus musculus GN=Parl PE=1 SV=1 364 561 6.0E-12
sp|Q5R5H4|PARL_PONAB Presenilins-associated rhomboid-like protein, mitochondrial OS=Pongo abelii GN=PARL PE=2 SV=1 364 561 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53259|PCP1_YEAST Rhomboid protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCP1 PE=1 SV=1 337 569 4.0E-15
sp|Q58EK4|PARL_DANRE Presenilins-associated rhomboid-like protein, mitochondrial OS=Danio rerio GN=parl PE=2 SV=1 369 561 6.0E-15
sp|Q3B8P0|PARL_RAT Presenilins-associated rhomboid-like protein, mitochondrial OS=Rattus norvegicus GN=Parl PE=2 SV=1 364 561 3.0E-12
sp|Q5XJY4|PARL_MOUSE Presenilins-associated rhomboid-like protein, mitochondrial OS=Mus musculus GN=Parl PE=1 SV=1 364 561 6.0E-12
sp|Q5R5H4|PARL_PONAB Presenilins-associated rhomboid-like protein, mitochondrial OS=Pongo abelii GN=PARL PE=2 SV=1 364 561 1.0E-11
sp|Q2KHV4|PARL_BOVIN Presenilins-associated rhomboid-like protein, mitochondrial OS=Bos taurus GN=PARL PE=2 SV=1 364 561 1.0E-11
sp|Q9H300|PARL_HUMAN Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2 364 561 1.0E-11
sp|O14364|YOHB_SCHPO Uncharacterized protein C13E7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13E7.11 PE=4 SV=1 357 553 3.0E-08
sp|Q9FZ81|RBL12_ARATH RHOMBOID-like protein 12, mitochondrial OS=Arabidopsis thaliana GN=RBL12 PE=2 SV=1 375 486 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0008236 serine-type peptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0044425 membrane part No
GO:0004175 endopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 335 357 22
2 451 470 19
3 474 496 22
4 503 525 22
5 540 557 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2112
MGSLWCPHASRALLRRTAARGFASSRGPRSQPPTALTTTTTTTLPRWLSSSACPPIGRRQDPRAWDAAAAALFFS
GPLSRHGQRRTLFSSAKIICRYEDLPREYRDKDGLAWGSRRMEAAEVKRIFGPDLGVDDANRLLRILHGRRVAGT
LEDPAFAIHTARFTAEQMAAGLTFLRDEVAVNEVVNAGLRAEDELDQMEQERQQRTARQTSDKGGKSVADRAKEE
VEEESEGGQEAAEGYKPDPVYGRSALDEIRARNVAKRKAREKALEEMMEAAKAREGARATTARAVAARRADKAAL
ATGGDEVRNAKVAAYYRKAQSDLSAPPPMTAWQRVLPSATLVALALAFMAAVCSVYEEPAARYRLLREVSASQAT
VGALVAANGLVWLAWRAPPLWRLLNRYMILVVATPRPVTLLTAVFSHSRLPHLVVNMVPLWLVGTRLHDELGRAD
FLALYLGCGALGFLGSLATYTARGWLTVTTLGASGATLGLCAAYFWEHRRDGFRLLGLPPDGVQGIVVLALLAAL
QLAGLGSTARLQIDLASHVVGMTAGVLGMELITRCRRRRAVPAAEAVDGDDEDGDNRAGDGARGSGREGAG*
Coding >Hirsu2|2112
ATGGGCAGCCTTTGGTGTCCGCACGCGTCGCGCGCCCTGCTGAGGCGGACCGCCGCCCGCGGCTTCGCGTCGTCC
CGGGGCCCGCGATCCCAACCGCCCACTGCGTTGACGACGACGACAACGACGACCCTGCCGCGATGGCTCTCGAGC
AGCGCTTGCCCCCCGATCGGCCGGCGGCAGGATCCGCGGGCGTGGGACGCCGCCGCCGCTGCCCTGTTCTTCTCT
GGGCCCCTCTCCCGCCACGGCCAACGACGGACGCTCTTCTCTTCCGCCAAAATCATCTGCCGGTACGAGGACCTG
CCGCGCGAATACCGTGACAAGGACGGCCTCGCGTGGGGAAGCCGGAGGATGGAGGCGGCCGAGGTCAAGAGAATC
TTCGGACCGGACCTGGGCGTCGACGACGCGAACCGGCTCCTGCGGATCCTGCACGGGCGACGGGTCGCCGGCACG
CTCGAGGACCCGGCCTTTGCCATCCACACGGCCCGCTTCACGGCCGAGCAGATGGCCGCCGGGCTGACGTTCCTG
CGGGACGAGGTGGCCGTCAACGAGGTCGTCAACGCGGGGCTCCGGGCCGAGGACGAGCTGGACCAGATGGAGCAG
GAGAGGCAGCAGCGGACGGCGCGCCAGACGAGCGACAAGGGCGGCAAGAGCGTTGCCGACCGTGCCAAGGAGGAG
GTGGAAGAGGAGAGTGAGGGCGGGCAAGAGGCGGCCGAGGGCTACAAGCCGGACCCGGTCTACGGGCGGAGCGCG
CTGGACGAGATACGGGCGCGCAACGTGGCGAAGCGCAAGGCCAGGGAGAAGGCGCTGGAGGAGATGATGGAGGCG
GCCAAGGCGCGGGAAGGGGCCAGAGCCACGACGGCGAGGGCGGTGGCGGCCAGGCGGGCGGACAAGGCGGCGCTG
GCGACGGGCGGCGACGAGGTGCGCAACGCCAAGGTGGCGGCGTACTATCGCAAGGCGCAGTCGGACCTGTCGGCG
CCGCCGCCGATGACGGCATGGCAGCGGGTGCTGCCGTCGGCGACGCTGGTGGCGCTGGCGCTGGCCTTCATGGCG
GCCGTGTGCAGCGTGTACGAGGAGCCGGCGGCGCGGTACCGGCTGCTGCGCGAGGTGTCGGCCTCGCAGGCGACG
GTGGGCGCGCTCGTGGCGGCCAACGGGCTGGTGTGGTTGGCGTGGAGGGCGCCGCCGCTCTGGCGGCTGCTCAAC
CGATACATGATCCTGGTGGTGGCGACGCCGCGGCCGGTGACGCTCCTCACGGCCGTCTTCTCGCACAGCCGGCTG
CCGCACCTGGTCGTCAACATGGTGCCGCTGTGGCTGGTCGGCACGCGGCTGCACGACGAGCTGGGCCGGGCCGAC
TTCCTCGCCCTCTACCTCGGCTGCGGCGCGCTCGGCTTCCTCGGCAGCCTGGCGACGTACACGGCGCGCGGCTGG
CTGACGGTGACGACGCTCGGCGCCTCGGGCGCCACCCTCGGCCTCTGCGCCGCCTACTTCTGGGAGCACCGCCGC
GACGGCTTCCGCCTGCTCGGCCTGCCGCCCGACGGCGTCCAGGGCATCGTCGTCCTCGCCCTGCTGGCCGCCCTC
CAGCTGGCCGGCCTGGGCTCGACGGCCCGGCTGCAGATCGACCTGGCGTCGCACGTGGTCGGCATGACGGCCGGC
GTCCTGGGCATGGAGCTCATCACGCGGTGCCGGCGGCGGCGGGCGGTGCCGGCGGCGGAGGCCGTTGACGGCGAC
GACGAAGACGGCGATAATAGGGCCGGCGACGGCGCGAGGGGCTCGGGCCGGGAGGGGGCCGGATGA
Transcript >Hirsu2|2112
ATGGGCAGCCTTTGGTGTCCGCACGCGTCGCGCGCCCTGCTGAGGCGGACCGCCGCCCGCGGCTTCGCGTCGTCC
CGGGGCCCGCGATCCCAACCGCCCACTGCGTTGACGACGACGACAACGACGACCCTGCCGCGATGGCTCTCGAGC
AGCGCTTGCCCCCCGATCGGCCGGCGGCAGGATCCGCGGGCGTGGGACGCCGCCGCCGCTGCCCTGTTCTTCTCT
GGGCCCCTCTCCCGCCACGGCCAACGACGGACGCTCTTCTCTTCCGCCAAAATCATCTGCCGGTACGAGGACCTG
CCGCGCGAATACCGTGACAAGGACGGCCTCGCGTGGGGAAGCCGGAGGATGGAGGCGGCCGAGGTCAAGAGAATC
TTCGGACCGGACCTGGGCGTCGACGACGCGAACCGGCTCCTGCGGATCCTGCACGGGCGACGGGTCGCCGGCACG
CTCGAGGACCCGGCCTTTGCCATCCACACGGCCCGCTTCACGGCCGAGCAGATGGCCGCCGGGCTGACGTTCCTG
CGGGACGAGGTGGCCGTCAACGAGGTCGTCAACGCGGGGCTCCGGGCCGAGGACGAGCTGGACCAGATGGAGCAG
GAGAGGCAGCAGCGGACGGCGCGCCAGACGAGCGACAAGGGCGGCAAGAGCGTTGCCGACCGTGCCAAGGAGGAG
GTGGAAGAGGAGAGTGAGGGCGGGCAAGAGGCGGCCGAGGGCTACAAGCCGGACCCGGTCTACGGGCGGAGCGCG
CTGGACGAGATACGGGCGCGCAACGTGGCGAAGCGCAAGGCCAGGGAGAAGGCGCTGGAGGAGATGATGGAGGCG
GCCAAGGCGCGGGAAGGGGCCAGAGCCACGACGGCGAGGGCGGTGGCGGCCAGGCGGGCGGACAAGGCGGCGCTG
GCGACGGGCGGCGACGAGGTGCGCAACGCCAAGGTGGCGGCGTACTATCGCAAGGCGCAGTCGGACCTGTCGGCG
CCGCCGCCGATGACGGCATGGCAGCGGGTGCTGCCGTCGGCGACGCTGGTGGCGCTGGCGCTGGCCTTCATGGCG
GCCGTGTGCAGCGTGTACGAGGAGCCGGCGGCGCGGTACCGGCTGCTGCGCGAGGTGTCGGCCTCGCAGGCGACG
GTGGGCGCGCTCGTGGCGGCCAACGGGCTGGTGTGGTTGGCGTGGAGGGCGCCGCCGCTCTGGCGGCTGCTCAAC
CGATACATGATCCTGGTGGTGGCGACGCCGCGGCCGGTGACGCTCCTCACGGCCGTCTTCTCGCACAGCCGGCTG
CCGCACCTGGTCGTCAACATGGTGCCGCTGTGGCTGGTCGGCACGCGGCTGCACGACGAGCTGGGCCGGGCCGAC
TTCCTCGCCCTCTACCTCGGCTGCGGCGCGCTCGGCTTCCTCGGCAGCCTGGCGACGTACACGGCGCGCGGCTGG
CTGACGGTGACGACGCTCGGCGCCTCGGGCGCCACCCTCGGCCTCTGCGCCGCCTACTTCTGGGAGCACCGCCGC
GACGGCTTCCGCCTGCTCGGCCTGCCGCCCGACGGCGTCCAGGGCATCGTCGTCCTCGCCCTGCTGGCCGCCCTC
CAGCTGGCCGGCCTGGGCTCGACGGCCCGGCTGCAGATCGACCTGGCGTCGCACGTGGTCGGCATGACGGCCGGC
GTCCTGGGCATGGAGCTCATCACGCGGTGCCGGCGGCGGCGGGCGGTGCCGGCGGCGGAGGCCGTTGACGGCGAC
GACGAAGACGGCGATAATAGGGCCGGCGACGGCGCGAGGGGCTCGGGCCGGGAGGGGGCCGGATGA
Gene >Hirsu2|2112
ATGGGCAGCCTTTGGTGTCCGCACGCGTCGCGCGCCCTGCTGAGGCGGACCGCCGCCCGCGGCTTCGCGTCGTCC
CGGGGCCCGCGATCCCAACCGCCCACTGCGTTGACGACGACGACAACGACGACCCTGCCGCGATGGCTCTCGAGC
AGCGCTTGCCCCCCGATCGGCCGGCGGCAGGATCCGCGGGCGTGGGACGCCGCCGCCGCTGCCCTGTTCTTCTCT
GGGCCCCTCTCCCGCCACGGCCAACGACGGACGCTCTTCTCTTCCGCCAAAATCATCTGCCGGTACGAGGACCTG
CCGCGCGAATACCGTGACAAGGACGGCCTCGCGTGGGGAAGCCGGAGGATGGAGGCGGCCGAGGTCAAGAGAATC
TTCGGACCGGACCTGGGCGTCGACGACGCGAACCGGCTCCTGCGGATCCTGCACGGGCGACGGGTCGCCGGCACG
CTCGAGGACCCGGCCTTTGCCATCCACACGGCCCGCTTCACGGCCGAGCAGATGGCCGCCGGGCTGACGTTCCTG
CGGGACGAGGTGGCCGTCAACGAGGTCGTCAACGCGGGGCTCCGGGCCGAGGACGAGCTGGACCAGATGGAGCAG
GAGAGGCAGCAGCGGACGGCGCGCCAGACGAGCGACAAGGGCGGCAAGAGCGTTGCCGACCGTGCCAAGGAGGAG
GTGGAAGAGGAGAGTGAGGGCGGGCAAGAGGCGGCCGAGGGCTACAAGCCGGACCCGGTCTACGGGCGGAGCGCG
CTGGACGAGATACGGGCGCGCAACGTGGCGAAGCGCAAGGCCAGGGAGAAGGCGCTGGAGGAGATGATGGAGGCG
GCCAAGGCGCGGGAAGGGGCCAGAGCCACGACGGCGAGGGCGGTGGCGGCCAGGCGGGCGGACAAGGCGGCGCTG
GCGACGGGCGGCGACGAGGTGCGCAACGCCAAGGTGGCGGCGTACTATCGCAAGGCGCAGTCGGACCTGTCGGCG
CCGCCGCCGATGACGGCATGGCAGCGGGTGCTGCCGTCGGCGACGCTGGTGGCGCTGGCGCTGGCCTTCATGGCG
GCCGTGTGCAGCGTGTACGAGGAGCCGGCGGCGCGGTACCGGCTGCTGCGCGAGGTGTCGGCCTCGCAGGCGACG
GTGGGCGCGCTCGTGGCGGCCAACGGGCTGGTGTGGTTGGCGTGGAGGGCGCCGCCGCTCTGGCGGCTGCTCAAC
CGATACATGATCCTGGTGGTGGCGACGCCGCGGCCGGTGACGCTCCTCACGGCCGTCTTCTCGCACAGCCGGCTG
CCGCACCTGGTCGTCAACATGGTGCCGCTGTGGCTGGTCGGCACGCGGCTGCACGACGAGCTGGGCCGGGCCGAC
TTCCTCGCCCTCTACCTCGGCTGCGGCGCGCTCGGCTTCCTCGGCAGCCTGGCGACGTACACGGCGCGCGGCTGG
CTGACGGTGACGACGCTCGGCGCCTCGGGCGCCACCCTCGGCCTCTGCGCCGCCTACTTCTGGGAGCACCGCCGC
GACGGCTTCCGCCTGCTCGGCCTGCCGCCCGACGGCGTCCAGGGCATCGTCGTCCTCGCCCTGCTGGCCGCCCTC
CAGCTGGCCGGCCTGGGCTCGACGGCCCGGCTGCAGATCGACCTGGCGTCGCACGTGGTCGGCATGACGGCCGGC
GTCCTGGGCATGGAGCTCATCACGCGGTGCCGGCGGCGGCGGGCGGTGCCGGCGGCGGAGGCCGTTGACGGCGAC
GACGAAGACGGCGATAATAGGGCCGGCGACGGCGCGAGGGGCTCGGGCCGGGAGGGGGCCGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail