Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2110
Gene name
LocationContig_1491:5517..6049
Strand+
Gene length (bp)532
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08288 PIGA PIGA (GPI anchor biosynthesis) 1.5E-47 45 134
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 4.4E-23 19 160
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 2.5E-11 20 159
PF13477 Glyco_trans_4_2 Glycosyl transferase 4-like 4.0E-06 24 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 6 161 4.0E-76
sp|B5VSZ6|GPI3_YEAS6 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SPT14 PE=3 SV=2 6 161 4.0E-76
sp|B3LKQ3|GPI3_YEAS1 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SPT14 PE=3 SV=1 6 161 4.0E-76
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 6 161 5.0E-76
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 10 161 1.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 6 161 4.0E-76
sp|B5VSZ6|GPI3_YEAS6 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SPT14 PE=3 SV=2 6 161 4.0E-76
sp|B3LKQ3|GPI3_YEAS1 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SPT14 PE=3 SV=1 6 161 4.0E-76
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 6 161 5.0E-76
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 10 161 1.0E-74
sp|P37287|PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens GN=PIGA PE=1 SV=1 4 160 3.0E-65
sp|Q64323|PIGA_MOUSE N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein OS=Mus musculus GN=Piga PE=2 SV=1 5 160 5.0E-65
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0045017 glycerolipid biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0006497 protein lipidation No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044267 cellular protein metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0008654 phospholipid biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0036211 protein modification process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0009058 biosynthetic process No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0019538 protein metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0006664 glycolipid metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2110
MARRTYNIAMVSDFFFPQPGGVESHIYQLSSKLIDRGHKVIIITHAHDDRKGVRYLTNGLKVYHVPFFVIYRHTT
FPTVFSFFPILRNICIRERIEIVHGHGSLSSLCHEGILHARTMGLRTVFTDHSLFGFADAASILTNKLLKFTLSD
VDHSICVSHTC*
Coding >Hirsu2|2110
ATGGCGCGGCGGACGTACAACATCGCCATGGTCAGCGACTTCTTCTTCCCGCAGCCCGGGGGCGTCGAGTCGCAC
ATCTACCAGCTGTCGAGCAAGCTGATCGACCGCGGGCACAAGGTCATCATCATCACGCACGCGCACGACGACCGC
AAGGGCGTGCGGTACCTGACCAACGGGCTCAAGGTCTACCACGTCCCCTTCTTCGTCATCTACCGGCACACGACC
TTCCCCACCGTCTTCTCCTTCTTCCCCATCCTGCGCAACATCTGCATCCGCGAGCGGATCGAGATCGTCCACGGC
CACGGCAGCCTGAGCAGCCTGTGCCACGAGGGCATCCTGCACGCCCGCACCATGGGCCTGCGCACCGTCTTCACC
GACCACTCGCTCTTCGGCTTCGCCGACGCCGCCAGCATCCTGACCAACAAGCTGCTCAAGTTCACCCTGAGCGAC
GTCGACCACAGCATCTGCGTCAGCCACACGTGCTGA
Transcript >Hirsu2|2110
ATGGCGCGGCGGACGTACAACATCGCCATGGTCAGCGACTTCTTCTTCCCGCAGCCCGGGGGCGTCGAGTCGCAC
ATCTACCAGCTGTCGAGCAAGCTGATCGACCGCGGGCACAAGGTCATCATCATCACGCACGCGCACGACGACCGC
AAGGGCGTGCGGTACCTGACCAACGGGCTCAAGGTCTACCACGTCCCCTTCTTCGTCATCTACCGGCACACGACC
TTCCCCACCGTCTTCTCCTTCTTCCCCATCCTGCGCAACATCTGCATCCGCGAGCGGATCGAGATCGTCCACGGC
CACGGCAGCCTGAGCAGCCTGTGCCACGAGGGCATCCTGCACGCCCGCACCATGGGCCTGCGCACCGTCTTCACC
GACCACTCGCTCTTCGGCTTCGCCGACGCCGCCAGCATCCTGACCAACAAGCTGCTCAAGTTCACCCTGAGCGAC
GTCGACCACAGCATCTGCGTCAGCCACACGTGCTGA
Gene >Hirsu2|2110
ATGGCGCGGCGGACGTACAACATCGCCATGGTCAGCGACTTCTTCTTCCCGCAGCCCGGGGGCGTCGAGTCGCAC
ATCTACCAGCTGTCGAGCAAGCTGATCGACCGCGGGCACAAGGTCATCATCATCACGCACGCGCACGACGACCGC
AAGGGCGTGCGGTACCTGACCAACGGGCTCAAGGTCTACCACGTCCCCTTCTTCGTCATCTACCGGCACACGACC
TTCCCCACCGTCTTCTCCTTCTTCCCCATCCTGCGCAACATCTGCATCCGCGAGCGGATCGAGATCGTCCACGGC
CACGGCAGCCTGAGCAGCCTGTGCCACGAGGGCATCCTGCACGCCCGCACCATGGGCCTGCGCACCGTCTTCACC
GACCACTCGCTCTTCGGCTTCGCCGACGCCGCCAGCATCCTGACCAACAAGCTGCTCAAGTTCACCCTGAGCGAC
GTCGACCACAGCATCTGCGTCAGCCACACGTGGTCAGTCGACGACTCCTCTCCTCCCTCCCCGCCCCGGCTTGGC
CAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail