Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2108
Gene name
LocationContig_1491:894..3645
Strand-
Gene length (bp)2751
Transcript length (bp)2751
Coding sequence length (bp)2751
Protein length (aa) 917

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.4E-15 362 460
PF00270 DEAD DEAD/DEAH box helicase 2.3E-12 528 614
PF00271 Helicase_C Helicase conserved C-terminal domain 1.8E-18 751 850
PF04851 ResIII Type III restriction enzyme, res subunit 1.1E-06 367 446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QA23|DBP6_ASPNC ATP-dependent RNA helicase dbp6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp6 PE=3 SV=1 271 663 3.0E-61
sp|A2QA23|DBP6_ASPNC ATP-dependent RNA helicase dbp6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp6 PE=3 SV=1 530 910 9.0E-47
sp|P26802|DDX51_DROME Probable ATP-dependent RNA helicase Dbp73D OS=Drosophila melanogaster GN=Dbp73D PE=2 SV=3 321 914 5.0E-46
sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 269 676 2.0E-42
sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 311 671 4.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QA23|DBP6_ASPNC ATP-dependent RNA helicase dbp6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp6 PE=3 SV=1 271 663 3.0E-61
sp|A2QA23|DBP6_ASPNC ATP-dependent RNA helicase dbp6 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp6 PE=3 SV=1 530 910 9.0E-47
sp|P26802|DDX51_DROME Probable ATP-dependent RNA helicase Dbp73D OS=Drosophila melanogaster GN=Dbp73D PE=2 SV=3 321 914 5.0E-46
sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 269 676 2.0E-42
sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 311 671 4.0E-40
sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza sativa subsp. japonica GN=Os02g0795900 PE=2 SV=1 324 671 3.0E-39
sp|Q8N8A6|DDX51_HUMAN ATP-dependent RNA helicase DDX51 OS=Homo sapiens GN=DDX51 PE=1 SV=3 321 683 1.0E-33
sp|Q6DRI7|DDX51_DANRE ATP-dependent RNA helicase DDX51 OS=Danio rerio GN=ddx51 PE=2 SV=1 320 670 2.0E-30
sp|A6ZSB3|DBP6_YEAS7 ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP6 PE=3 SV=1 265 665 4.0E-30
sp|P53734|DBP6_YEAST ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP6 PE=1 SV=1 265 667 5.0E-30
sp|Q8N8A6|DDX51_HUMAN ATP-dependent RNA helicase DDX51 OS=Homo sapiens GN=DDX51 PE=1 SV=3 526 906 2.0E-28
sp|Q4P3W3|DBP10_USTMA ATP-dependent RNA helicase DBP10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP10 PE=3 SV=1 339 863 2.0E-28
sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 749 912 7.0E-27
sp|Q6P9R1|DDX51_MOUSE ATP-dependent RNA helicase DDX51 OS=Mus musculus GN=Ddx51 PE=1 SV=1 289 683 7.0E-27
sp|A5DK47|DBP6_PICGU ATP-dependent RNA helicase DBP6 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP6 PE=3 SV=2 264 436 5.0E-26
sp|A3LSJ2|DBP6_PICST ATP-dependent RNA helicase DBP6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP6 PE=3 SV=2 731 912 8.0E-26
sp|Q4P0Y5|DBP7_USTMA ATP-dependent RNA helicase DBP7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP7 PE=3 SV=1 339 866 9.0E-25
sp|Q59MW2|DBP6_CANAL ATP-dependent RNA helicase DBP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP6 PE=3 SV=1 747 910 1.0E-24
sp|A7TGW7|DBP10_VANPO ATP-dependent RNA helicase DBP10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP10 PE=3 SV=1 526 863 3.0E-23
sp|Q6CDN5|DBP6_YARLI ATP-dependent RNA helicase DBP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP6 PE=3 SV=1 753 910 5.0E-23
sp|A3LSJ2|DBP6_PICST ATP-dependent RNA helicase DBP6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP6 PE=3 SV=2 295 467 2.0E-22
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 339 867 6.0E-22
sp|Q54BD6|DDX51_DICDI Probable ATP-dependent RNA helicase ddx51 OS=Dictyostelium discoideum GN=ddx51 PE=3 SV=1 352 670 9.0E-22
sp|A5DZT7|DBP10_LODEL ATP-dependent RNA helicase DBP10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP10 PE=3 SV=1 525 863 9.0E-22
sp|Q6BL34|DBP10_DEBHA ATP-dependent RNA helicase DBP10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP10 PE=3 SV=2 526 901 9.0E-22
sp|Q12389|DBP10_YEAST ATP-dependent RNA helicase DBP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP10 PE=1 SV=2 531 863 1.0E-21
sp|A6ZXU0|DBP10_YEAS7 ATP-dependent RNA helicase DBP10 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP10 PE=3 SV=1 531 863 2.0E-21
sp|Q2GZU7|DBP7_CHAGB ATP-dependent RNA helicase DBP7 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP7 PE=3 SV=1 530 859 2.0E-21
sp|Q7S873|DBP7_NEUCR ATP-dependent RNA helicase dbp-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-7 PE=3 SV=1 530 867 2.0E-21
sp|Q0UHM7|DBP7_PHANO ATP-dependent RNA helicase DBP7 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP7 PE=3 SV=1 530 859 2.0E-21
sp|Q4HZ68|DBP7_GIBZE ATP-dependent RNA helicase DBP7 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP7 PE=3 SV=1 530 867 3.0E-21
sp|A5E726|DBP6_LODEL ATP-dependent RNA helicase DBP6 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP6 PE=3 SV=1 745 906 7.0E-21
sp|A3LZT3|DBP10_PICST ATP-dependent RNA helicase DBP10 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP10 PE=3 SV=2 526 863 1.0E-20
sp|Q6BPT8|DBP6_DEBHA ATP-dependent RNA helicase DBP6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP6 PE=3 SV=2 531 674 1.0E-20
sp|Q6FNA2|DBP10_CANGA ATP-dependent RNA helicase DBP10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP10 PE=3 SV=1 531 863 2.0E-20
sp|A3LWH3|DBP7_PICST ATP-dependent RNA helicase DBP7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DPB7 PE=3 SV=2 530 871 2.0E-20
sp|A5DK47|DBP6_PICGU ATP-dependent RNA helicase DBP6 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP6 PE=3 SV=2 726 912 3.0E-20
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 507 863 5.0E-20
sp|Q751D1|DBP6_ASHGO ATP-dependent RNA helicase DBP6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP6 PE=3 SV=1 752 911 6.0E-20
sp|Q6BPT8|DBP6_DEBHA ATP-dependent RNA helicase DBP6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP6 PE=3 SV=2 745 911 1.0E-19
sp|A7F8V8|DBP7_SCLS1 ATP-dependent RNA helicase dbp7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp7 PE=3 SV=1 530 859 1.0E-19
sp|A5DK47|DBP6_PICGU ATP-dependent RNA helicase DBP6 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP6 PE=3 SV=2 531 720 2.0E-19
sp|Q59MW2|DBP6_CANAL ATP-dependent RNA helicase DBP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP6 PE=3 SV=1 281 428 2.0E-19
sp|Q6FST5|DBP6_CANGA ATP-dependent RNA helicase DBP6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP6 PE=3 SV=1 752 868 4.0E-19
sp|Q6CKZ4|DBP6_KLULA ATP-dependent RNA helicase DBP6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP6 PE=3 SV=1 744 870 5.0E-19
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 531 913 5.0E-19
sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 531 867 6.0E-19
sp|A6RSH5|DBP7_BOTFB ATP-dependent RNA helicase dbp7 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp7 PE=3 SV=1 530 859 7.0E-19
sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 531 867 8.0E-19
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 531 867 9.0E-19
sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 530 859 9.0E-19
sp|Q59MW2|DBP6_CANAL ATP-dependent RNA helicase DBP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP6 PE=3 SV=1 531 670 1.0E-18
sp|A5E726|DBP6_LODEL ATP-dependent RNA helicase DBP6 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP6 PE=3 SV=1 298 428 1.0E-18
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 356 671 1.0E-18
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 356 671 1.0E-18
sp|Q6BPT8|DBP6_DEBHA ATP-dependent RNA helicase DBP6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP6 PE=3 SV=2 292 468 2.0E-18
sp|Q751D1|DBP6_ASHGO ATP-dependent RNA helicase DBP6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP6 PE=3 SV=1 247 468 2.0E-18
sp|Q6CIR0|DBP10_KLULA ATP-dependent RNA helicase DBP10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP10 PE=3 SV=1 531 863 3.0E-18
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 531 867 4.0E-18
sp|A4R5B8|DBP10_MAGO7 ATP-dependent RNA helicase DBP10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP10 PE=3 SV=1 339 861 4.0E-18
sp|A5E726|DBP6_LODEL ATP-dependent RNA helicase DBP6 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP6 PE=3 SV=1 531 673 5.0E-18
sp|A7TFZ9|DBP6_VANPO ATP-dependent RNA helicase DBP6 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP6 PE=3 SV=1 531 670 1.0E-17
sp|Q1E9T9|DBP7_COCIM ATP-dependent RNA helicase DBP7 OS=Coccidioides immitis (strain RS) GN=DBP7 PE=3 SV=1 530 905 1.0E-17
sp|Q6FST5|DBP6_CANGA ATP-dependent RNA helicase DBP6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP6 PE=3 SV=1 255 468 2.0E-17
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 752 877 2.0E-17
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 531 867 3.0E-17
sp|A4QX49|DBP7_MAGO7 ATP-dependent RNA helicase DBP7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP7 PE=3 SV=1 530 874 5.0E-17
sp|A7TFZ9|DBP6_VANPO ATP-dependent RNA helicase DBP6 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP6 PE=3 SV=1 295 468 7.0E-17
sp|A3LSJ2|DBP6_PICST ATP-dependent RNA helicase DBP6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP6 PE=3 SV=2 531 682 2.0E-16
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 752 861 3.0E-16
sp|Q6FST5|DBP6_CANGA ATP-dependent RNA helicase DBP6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP6 PE=3 SV=1 531 664 4.0E-16
sp|Q6DRI7|DDX51_DANRE ATP-dependent RNA helicase DDX51 OS=Danio rerio GN=ddx51 PE=2 SV=1 753 915 5.0E-16
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 352 671 5.0E-16
sp|Q5BGX6|DBP7_EMENI ATP-dependent RNA helicase dbp7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp7 PE=3 SV=1 530 859 6.0E-16
sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza sativa subsp. japonica GN=Os02g0795900 PE=2 SV=1 752 867 1.0E-15
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 744 903 1.0E-15
sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP7 PE=3 SV=3 530 871 1.0E-15
sp|Q6CKZ4|DBP6_KLULA ATP-dependent RNA helicase DBP6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP6 PE=3 SV=1 531 671 2.0E-15
sp|A1DE84|DBP7_NEOFI ATP-dependent RNA helicase dbp7 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp7 PE=3 SV=1 530 859 2.0E-15
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 752 861 2.0E-15
sp|A1CB55|DBP7_ASPCL ATP-dependent RNA helicase dbp7 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp7 PE=3 SV=1 530 859 2.0E-15
sp|Q4WV71|DBP7_ASPFU ATP-dependent RNA helicase dbp7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp7 PE=3 SV=1 530 859 2.0E-15
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 337 571 2.0E-15
sp|Q751D1|DBP6_ASHGO ATP-dependent RNA helicase DBP6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP6 PE=3 SV=1 531 646 3.0E-15
sp|P0CR06|DBP10_CRYNJ ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP10 PE=3 SV=1 750 867 3.0E-15
sp|P0CR07|DBP10_CRYNB ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP10 PE=3 SV=1 750 867 3.0E-15
sp|Q757U8|DBP10_ASHGO ATP-dependent RNA helicase DBP10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP10 PE=3 SV=1 780 863 3.0E-15
sp|A5DLR3|DBP10_PICGU ATP-dependent RNA helicase DBP10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP10 PE=3 SV=2 780 863 5.0E-15
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 752 916 6.0E-15
sp|Q4P9E5|SPB4_USTMA ATP-dependent rRNA helicase SPB4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPB4 PE=3 SV=2 346 634 7.0E-15
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 337 579 7.0E-15
sp|Q5ANB2|DBP10_CANAL ATP-dependent RNA helicase DBP10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP10 PE=3 SV=1 750 863 1.0E-14
sp|Q90WU3|DDX1_CHICK ATP-dependent RNA helicase DDX1 OS=Gallus gallus GN=DDX1 PE=1 SV=1 530 892 1.0E-14
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 752 861 1.0E-14
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 752 861 1.0E-14
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 352 690 1.0E-14
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 752 861 2.0E-14
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 752 861 2.0E-14
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 753 915 2.0E-14
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 753 910 2.0E-14
sp|A6ZSB3|DBP6_YEAS7 ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP6 PE=3 SV=1 752 894 3.0E-14
sp|P53734|DBP6_YEAST ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP6 PE=1 SV=1 752 894 3.0E-14
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 753 859 3.0E-14
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 753 864 3.0E-14
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 751 863 3.0E-14
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 356 690 4.0E-14
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 746 859 4.0E-14
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 753 894 4.0E-14
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 751 868 4.0E-14
sp|Q6CDN5|DBP6_YARLI ATP-dependent RNA helicase DBP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP6 PE=3 SV=1 339 432 5.0E-14
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 753 859 5.0E-14
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 746 859 6.0E-14
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 753 915 6.0E-14
sp|Q6BV58|MAK5_DEBHA ATP-dependent RNA helicase MAK5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MAK5 PE=3 SV=1 752 889 7.0E-14
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 751 868 7.0E-14
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 753 867 7.0E-14
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 752 863 8.0E-14
sp|Q59ZH9|MAK5_CANAL ATP-dependent RNA helicase MAK5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAK5 PE=3 SV=1 752 864 8.0E-14
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 752 861 8.0E-14
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 753 905 8.0E-14
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 752 914 9.0E-14
sp|Q93Y39|RH13_ARATH DEAD-box ATP-dependent RNA helicase 13 OS=Arabidopsis thaliana GN=RH13 PE=2 SV=3 753 868 9.0E-14
sp|Q6P9R1|DDX51_MOUSE ATP-dependent RNA helicase DDX51 OS=Mus musculus GN=Ddx51 PE=1 SV=1 753 906 1.0E-13
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 743 855 1.0E-13
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 753 867 1.0E-13
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 753 855 1.0E-13
sp|Q86IZ9|DDX52_DICDI Probable ATP-dependent RNA helicase ddx52 OS=Dictyostelium discoideum GN=ddx52 PE=3 SV=1 750 861 1.0E-13
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 738 867 1.0E-13
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 752 861 2.0E-13
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 753 860 2.0E-13
sp|P0CQ94|DBP7_CRYNJ ATP-dependent RNA helicase DBP7 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP7 PE=3 SV=1 777 876 2.0E-13
sp|P0CQ95|DBP7_CRYNB ATP-dependent RNA helicase DBP7 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP7 PE=3 SV=1 777 876 2.0E-13
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 751 863 2.0E-13
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 753 861 2.0E-13
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 753 864 2.0E-13
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 742 868 2.0E-13
sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 791 867 2.0E-13
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 752 861 3.0E-13
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 753 860 3.0E-13
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 753 859 3.0E-13
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 779 859 3.0E-13
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 753 859 3.0E-13
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 753 863 3.0E-13
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 753 860 3.0E-13
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 753 855 3.0E-13
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 753 855 3.0E-13
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 792 864 4.0E-13
sp|Q4P7Z8|DBP5_USTMA ATP-dependent RNA helicase DBP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP5 PE=3 SV=1 753 908 4.0E-13
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 791 863 4.0E-13
sp|Q7SFC8|ROK1_NEUCR ATP-dependent RNA helicase rok1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-16 PE=3 SV=1 750 863 4.0E-13
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 779 862 4.0E-13
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 779 862 4.0E-13
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 753 860 4.0E-13
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 753 876 4.0E-13
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 749 861 5.0E-13
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 742 868 5.0E-13
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 752 866 5.0E-13
sp|Q4IPI1|ROK1_GIBZE ATP-dependent RNA helicase ROK1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ROK1 PE=3 SV=1 750 853 6.0E-13
sp|Q2UQW3|ROK1_ASPOR ATP-dependent RNA helicase rok1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rok1 PE=3 SV=1 740 853 6.0E-13
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 753 874 6.0E-13
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 334 571 6.0E-13
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 753 861 6.0E-13
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 753 859 6.0E-13
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 753 874 6.0E-13
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 752 859 7.0E-13
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 753 860 8.0E-13
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 753 855 8.0E-13
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 752 896 8.0E-13
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 752 867 9.0E-13
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 792 855 9.0E-13
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 753 859 9.0E-13
sp|Q6C835|DBP7_YARLI ATP-dependent RNA helicase DBP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP7 PE=3 SV=1 770 859 9.0E-13
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 792 855 1.0E-12
sp|A1CNK1|ROK1_ASPCL ATP-dependent RNA helicase rok1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rok1 PE=3 SV=1 740 853 1.0E-12
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 779 861 1.0E-12
sp|Q2NQB2|RHLB_SODGM ATP-dependent RNA helicase RhlB OS=Sodalis glossinidius (strain morsitans) GN=rhlB PE=3 SV=1 779 862 1.0E-12
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 753 863 1.0E-12
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 753 874 1.0E-12
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 753 855 1.0E-12
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 779 862 1.0E-12
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 790 867 1.0E-12
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 790 867 1.0E-12
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 779 863 1.0E-12
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 748 863 1.0E-12
sp|A0KEG9|RHLB_AERHH ATP-dependent RNA helicase RhlB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rhlB PE=3 SV=1 779 862 1.0E-12
sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 752 867 2.0E-12
sp|Q6CKZ4|DBP6_KLULA ATP-dependent RNA helicase DBP6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP6 PE=3 SV=1 298 431 2.0E-12
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 752 914 2.0E-12
sp|A5DUB2|MAK5_LODEL ATP-dependent RNA helicase MAK5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MAK5 PE=3 SV=1 753 864 2.0E-12
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 753 860 2.0E-12
sp|B7VME9|RHLB_VIBTL ATP-dependent RNA helicase RhlB OS=Vibrio tasmaniensis (strain LGP32) GN=rhlB PE=3 SV=1 779 862 2.0E-12
sp|A1D1E3|ROK1_NEOFI ATP-dependent RNA helicase rok1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rok1 PE=3 SV=1 740 853 2.0E-12
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 751 863 2.0E-12
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 792 891 2.0E-12
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 752 895 2.0E-12
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 753 860 2.0E-12
sp|P34668|YO12_CAEEL Putative ATP-dependent RNA helicase ZK686.2 OS=Caenorhabditis elegans GN=ZK686.2 PE=3 SV=2 737 906 2.0E-12
sp|Q0CMB0|ROK1_ASPTN ATP-dependent RNA helicase rok1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rok1 PE=3 SV=2 750 853 2.0E-12
sp|Q6CJU1|DBP5_KLULA ATP-dependent RNA helicase DBP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP5 PE=3 SV=1 753 891 2.0E-12
sp|Q54BD6|DDX51_DICDI Probable ATP-dependent RNA helicase ddx51 OS=Dictyostelium discoideum GN=ddx51 PE=3 SV=1 740 874 3.0E-12
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 746 864 3.0E-12
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 752 860 3.0E-12
sp|A2QAB5|ROK1_ASPNC ATP-dependent RNA helicase rok1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rok1 PE=3 SV=2 740 853 3.0E-12
sp|C4LB49|RHLB_TOLAT ATP-dependent RNA helicase RhlB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhlB PE=3 SV=1 779 862 3.0E-12
sp|Q1E306|ROK1_COCIM ATP-dependent RNA helicase ROK1 OS=Coccidioides immitis (strain RS) GN=ROK1 PE=3 SV=1 750 891 3.0E-12
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 752 867 3.0E-12
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 746 864 3.0E-12
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 791 861 3.0E-12
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 675 863 3.0E-12
sp|P20449|DBP5_YEAST ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP5 PE=1 SV=2 780 888 3.0E-12
sp|A6ZNQ1|DBP5_YEAS7 ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP5 PE=3 SV=1 780 888 3.0E-12
sp|Q54TD7|DDX24_DICDI ATP-dependent RNA helicase ddx24 OS=Dictyostelium discoideum GN=ddx24 PE=3 SV=1 753 860 4.0E-12
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 752 866 4.0E-12
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 752 862 4.0E-12
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 717 859 4.0E-12
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 779 862 4.0E-12
sp|A4STJ7|RHLB_AERS4 ATP-dependent RNA helicase RhlB OS=Aeromonas salmonicida (strain A449) GN=rhlB PE=3 SV=1 779 862 4.0E-12
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 779 859 4.0E-12
sp|Q4WRH5|ROK1_ASPFU ATP-dependent RNA helicase rok1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rok1 PE=3 SV=1 740 853 4.0E-12
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 792 864 4.0E-12
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 758 860 5.0E-12
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 792 860 5.0E-12
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 749 863 5.0E-12
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 780 893 5.0E-12
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 752 861 5.0E-12
sp|Q8TFL3|DBP7_CANGA ATP-dependent RNA helicase DBP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP7 PE=3 SV=1 530 867 6.0E-12
sp|Q65RG7|RHLB_MANSM ATP-dependent RNA helicase RhlB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rhlB PE=3 SV=1 752 862 6.0E-12
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 753 861 6.0E-12
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 753 878 6.0E-12
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 753 859 6.0E-12
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 753 905 6.0E-12
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 753 905 6.0E-12
sp|A3GG51|MAK5_PICST ATP-dependent RNA helicase MAK5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MAK5 PE=3 SV=2 752 864 6.0E-12
sp|Q6C3X7|DBP5_YARLI ATP-dependent RNA helicase DBP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP5 PE=3 SV=1 779 893 6.0E-12
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 773 891 6.0E-12
sp|Q2HCV7|ROK1_CHAGB ATP-dependent RNA helicase ROK1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ROK1 PE=3 SV=1 772 863 7.0E-12
sp|C4K8M8|RHLB_HAMD5 ATP-dependent RNA helicase RhlB OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rhlB PE=3 SV=1 752 861 7.0E-12
sp|Q40467|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1 785 867 7.0E-12
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 808 859 7.0E-12
sp|P0CQ90|MAK5_CRYNJ ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MAK5 PE=3 SV=1 780 863 7.0E-12
sp|A4RMV8|ROK1_MAGO7 ATP-dependent RNA helicase ROK1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ROK1 PE=3 SV=1 750 853 7.0E-12
sp|B4F1V3|RHLB_PROMH ATP-dependent RNA helicase RhlB OS=Proteus mirabilis (strain HI4320) GN=rhlB PE=3 SV=1 752 862 7.0E-12
sp|P0CQ91|MAK5_CRYNB ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MAK5 PE=3 SV=1 780 863 7.0E-12
sp|Q9SF41|RH45_ARATH DEAD-box ATP-dependent RNA helicase 45 OS=Arabidopsis thaliana GN=RH45 PE=3 SV=1 764 866 8.0E-12
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 789 903 8.0E-12
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 792 903 8.0E-12
sp|Q6Z2Z4|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1 785 867 8.0E-12
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 752 859 8.0E-12
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 788 865 8.0E-12
sp|P35683|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2 785 867 9.0E-12
sp|Q55CP6|DDX1_DICDI Probable ATP-dependent RNA helicase ddx1 OS=Dictyostelium discoideum GN=ddx1 PE=3 SV=1 785 885 9.0E-12
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 779 862 9.0E-12
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 746 864 9.0E-12
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 789 867 9.0E-12
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 789 903 9.0E-12
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 789 903 9.0E-12
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 789 903 9.0E-12
sp|P21507|SRMB_ECOLI ATP-dependent RNA helicase SrmB OS=Escherichia coli (strain K12) GN=srmB PE=1 SV=1 806 873 9.0E-12
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 744 863 9.0E-12
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 806 859 9.0E-12
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 753 863 9.0E-12
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 792 903 9.0E-12
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 752 862 9.0E-12
sp|A7TFZ9|DBP6_VANPO ATP-dependent RNA helicase DBP6 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP6 PE=3 SV=1 753 869 1.0E-11
sp|Q75C39|DBP5_ASHGO ATP-dependent RNA helicase DBP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP5 PE=3 SV=2 807 891 1.0E-11
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 749 859 1.0E-11
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 749 859 1.0E-11
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 752 883 1.0E-11
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 752 861 1.0E-11
sp|Q6BZ77|DBP3_DEBHA ATP-dependent RNA helicase DBP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP3 PE=3 SV=1 752 863 1.0E-11
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 752 863 1.0E-11
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 753 863 1.0E-11
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 753 863 1.0E-11
sp|P41381|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1 785 867 1.0E-11
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 746 864 1.0E-11
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 752 915 1.0E-11
sp|Q15N18|RHLB_PSEA6 ATP-dependent RNA helicase RhlB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rhlB PE=3 SV=1 779 861 1.0E-11
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 753 865 1.0E-11
sp|Q6FKN8|DBP5_CANGA ATP-dependent RNA helicase DBP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP5 PE=3 SV=1 779 871 1.0E-11
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 752 861 1.0E-11
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 780 891 1.0E-11
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 753 898 1.0E-11
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 780 891 1.0E-11
sp|Q5BET6|ROK1_EMENI ATP-dependent RNA helicase rok1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rok1 PE=3 SV=1 740 853 1.0E-11
sp|A1SZG4|RHLB_PSYIN ATP-dependent RNA helicase RhlB OS=Psychromonas ingrahamii (strain 37) GN=rhlB PE=3 SV=1 779 861 1.0E-11
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 753 863 1.0E-11
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 753 855 1.0E-11
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 780 891 1.0E-11
sp|P41382|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1 785 863 1.0E-11
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 792 860 1.0E-11
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 746 864 1.0E-11
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 788 864 1.0E-11
sp|Q6CDN5|DBP6_YARLI ATP-dependent RNA helicase DBP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP6 PE=3 SV=1 531 690 2.0E-11
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 753 916 2.0E-11
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 780 891 2.0E-11
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 780 891 2.0E-11
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 780 891 2.0E-11
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 780 891 2.0E-11
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 792 891 2.0E-11
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 792 891 2.0E-11
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 780 891 2.0E-11
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 792 863 2.0E-11
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 808 902 2.0E-11
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 753 855 2.0E-11
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 779 891 2.0E-11
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 752 861 2.0E-11
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 752 861 2.0E-11
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 753 895 2.0E-11
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 726 861 2.0E-11
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 792 864 2.0E-11
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 792 891 2.0E-11
sp|B1JQ11|RHLB_YERPY ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|Q66G19|RHLB_YERPS ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|A4TRC8|RHLB_YERPP ATP-dependent RNA helicase RhlB OS=Yersinia pestis (strain Pestoides F) GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|Q1CNK3|RHLB_YERPN ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|Q8ZAD8|RHLB_YERPE ATP-dependent RNA helicase RhlB OS=Yersinia pestis GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|B2K046|RHLB_YERPB ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|Q1CBQ4|RHLB_YERPA ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|A7FD47|RHLB_YERP3 ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rhlB PE=3 SV=1 752 862 2.0E-11
sp|Q40470|IF4A7_TOBAC Eukaryotic initiation factor 4A-7 OS=Nicotiana tabacum PE=2 SV=1 785 863 2.0E-11
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 753 866 2.0E-11
sp|P41376|IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana GN=TIF4A-1 PE=1 SV=1 785 867 2.0E-11
sp|Q41741|IF4A_MAIZE Eukaryotic initiation factor 4A OS=Zea mays PE=2 SV=1 785 867 2.0E-11
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 753 898 2.0E-11
sp|Q9LFN6|RH56_ARATH DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=1 SV=2 753 860 2.0E-11
sp|Q56XG6|RH15_ARATH DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=1 SV=3 753 860 2.0E-11
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 752 861 2.0E-11
sp|A8G828|RHLB_SERP5 ATP-dependent RNA helicase RhlB OS=Serratia proteamaculans (strain 568) GN=rhlB PE=3 SV=1 779 862 2.0E-11
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 808 864 2.0E-11
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 753 874 2.0E-11
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 753 863 2.0E-11
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 752 859 2.0E-11
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 753 855 2.0E-11
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 753 858 2.0E-11
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 753 916 2.0E-11
sp|Q8Y755|CSHB_LISMO DEAD-box ATP-dependent RNA helicase CshB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshB PE=2 SV=1 752 858 2.0E-11
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 752 863 2.0E-11
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 753 855 2.0E-11
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 753 855 2.0E-11
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 779 862 2.0E-11
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 753 905 2.0E-11
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 753 855 2.0E-11
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 779 862 2.0E-11
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 779 862 2.0E-11
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 779 862 2.0E-11
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 792 864 2.0E-11
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 792 864 2.0E-11
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 339 658 3.0E-11
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 779 862 3.0E-11
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 753 855 3.0E-11
sp|Q4PEX7|DBP8_USTMA ATP-dependent RNA helicase DBP8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP8 PE=3 SV=2 749 861 3.0E-11
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 752 859 3.0E-11
sp|Q0UG00|MS116_PHANO ATP-dependent RNA helicase MSS116, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSS116 PE=3 SV=1 779 873 3.0E-11
sp|Q61R02|DDX55_CAEBR Probable ATP-dependent RNA helicase DDX55 homolog OS=Caenorhabditis briggsae GN=CBG06798 PE=3 SV=1 796 866 3.0E-11
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 752 863 3.0E-11
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 792 864 3.0E-11
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 768 909 3.0E-11
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 753 861 3.0E-11
sp|P41379|IF4A2_NICPL Eukaryotic initiation factor 4A-2 OS=Nicotiana plumbaginifolia PE=2 SV=1 785 867 3.0E-11
sp|Q755W0|FAL1_ASHGO ATP-dependent RNA helicase FAL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FAL1 PE=3 SV=2 749 863 3.0E-11
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 792 859 3.0E-11
sp|Q5RDL2|DDX24_PONAB ATP-dependent RNA helicase DDX24 OS=Pongo abelii GN=DDX24 PE=2 SV=1 753 867 3.0E-11
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 792 860 3.0E-11
sp|B6EPA4|RHLB_ALISL ATP-dependent RNA helicase RhlB OS=Aliivibrio salmonicida (strain LFI1238) GN=rhlB PE=3 SV=1 779 862 3.0E-11
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 808 902 3.0E-11
sp|Q0I1X0|RHLB_HAES1 ATP-dependent RNA helicase RhlB OS=Haemophilus somnus (strain 129Pt) GN=rhlB PE=3 SV=1 752 862 3.0E-11
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 753 909 3.0E-11
sp|A5DPU0|MAK5_PICGU ATP-dependent RNA helicase MAK5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MAK5 PE=3 SV=1 753 873 3.0E-11
sp|B0UUZ9|RHLB_HISS2 ATP-dependent RNA helicase RhlB OS=Histophilus somni (strain 2336) GN=rhlB PE=3 SV=1 752 862 3.0E-11
sp|Q8XAT4|RHLB_ECO57 ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 GN=rhlB PE=3 SV=3 779 862 3.0E-11
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 792 863 4.0E-11
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 808 914 4.0E-11
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 808 914 4.0E-11
sp|Q9GZR7|DDX24_HUMAN ATP-dependent RNA helicase DDX24 OS=Homo sapiens GN=DDX24 PE=1 SV=1 753 867 4.0E-11
sp|B2VG58|RHLB_ERWT9 ATP-dependent RNA helicase RhlB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rhlB PE=3 SV=1 779 862 4.0E-11
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 753 884 4.0E-11
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 753 860 4.0E-11
sp|Q9ESV0|DDX24_MOUSE ATP-dependent RNA helicase DDX24 OS=Mus musculus GN=Ddx24 PE=1 SV=2 753 867 4.0E-11
sp|Q40471|IF4A9_TOBAC Eukaryotic initiation factor 4A-9 OS=Nicotiana tabacum PE=2 SV=1 785 863 4.0E-11
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 745 863 4.0E-11
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 790 863 4.0E-11
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 753 855 4.0E-11
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 752 859 4.0E-11
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 752 864 4.0E-11
sp|Q6BT27|FAL1_DEBHA ATP-dependent RNA helicase FAL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FAL1 PE=3 SV=1 792 891 4.0E-11
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 752 864 4.0E-11
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 751 866 4.0E-11
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 768 859 4.0E-11
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 806 916 4.0E-11
sp|Q40468|IF415_TOBAC Eukaryotic initiation factor 4A-15 OS=Nicotiana tabacum PE=2 SV=1 785 863 4.0E-11
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 752 866 4.0E-11
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 753 858 4.0E-11
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 753 855 4.0E-11
sp|Q6CCZ1|PRP5_YARLI Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP5 PE=3 SV=1 750 863 4.0E-11
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 803 859 4.0E-11
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 743 863 4.0E-11
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 792 865 5.0E-11
sp|Q40469|IF4A6_TOBAC Eukaryotic initiation factor 4A-6 (Fragment) OS=Nicotiana tabacum PE=2 SV=1 785 863 5.0E-11
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 780 859 5.0E-11
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 806 863 5.0E-11
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 806 863 5.0E-11
sp|P23394|PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP28 PE=1 SV=2 750 864 5.0E-11
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 792 865 5.0E-11
sp|A6TGG9|RHLB_KLEP7 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rhlB PE=3 SV=1 779 862 5.0E-11
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 752 873 5.0E-11
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 752 864 5.0E-11
sp|Q9FZ92|RH44_ARATH Putative DEAD-box ATP-dependent RNA helicase 44 OS=Arabidopsis thaliana GN=RH44 PE=5 SV=2 778 869 5.0E-11
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 744 864 5.0E-11
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 808 867 5.0E-11
sp|P41377|IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana GN=TIF4A-2 PE=1 SV=1 785 867 5.0E-11
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 808 867 5.0E-11
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 808 898 5.0E-11
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 792 855 5.0E-11
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 753 859 5.0E-11
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 792 864 5.0E-11
sp|A4WG30|RHLB_ENT38 ATP-dependent RNA helicase RhlB OS=Enterobacter sp. (strain 638) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|Q66HG7|DDX59_RAT Probable ATP-dependent RNA helicase DDX59 OS=Rattus norvegicus GN=Ddx59 PE=2 SV=1 754 868 6.0E-11
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 808 864 6.0E-11
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 752 861 6.0E-11
sp|Q54TF8|DDX19_DICDI ATP-dependent RNA helicase ddx19 OS=Dictyostelium discoideum GN=helC PE=2 SV=1 788 877 6.0E-11
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 792 864 6.0E-11
sp|P0A2P0|RHLB_SALTY ATP-dependent RNA helicase RhlB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rhlB PE=3 SV=2 779 862 6.0E-11
sp|P0A2P1|RHLB_SALTI ATP-dependent RNA helicase RhlB OS=Salmonella typhi GN=rhlB PE=3 SV=2 779 862 6.0E-11
sp|B4TNT3|RHLB_SALSV ATP-dependent RNA helicase RhlB OS=Salmonella schwarzengrund (strain CVM19633) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|C0Q2V9|RHLB_SALPC ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi C (strain RKS4594) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|A9MXF3|RHLB_SALPB ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|B4SZ26|RHLB_SALNS ATP-dependent RNA helicase RhlB OS=Salmonella newport (strain SL254) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|B4TB13|RHLB_SALHS ATP-dependent RNA helicase RhlB OS=Salmonella heidelberg (strain SL476) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|B5RFS3|RHLB_SALG2 ATP-dependent RNA helicase RhlB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|B5QVH2|RHLB_SALEP ATP-dependent RNA helicase RhlB OS=Salmonella enteritidis PT4 (strain P125109) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|Q57HT6|RHLB_SALCH ATP-dependent RNA helicase RhlB OS=Salmonella choleraesuis (strain SC-B67) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|B5EZ40|RHLB_SALA4 ATP-dependent RNA helicase RhlB OS=Salmonella agona (strain SL483) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 792 912 6.0E-11
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 746 873 6.0E-11
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 792 864 6.0E-11
sp|B5FN74|RHLB_SALDC ATP-dependent RNA helicase RhlB OS=Salmonella dublin (strain CT_02021853) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|B5BIS9|RHLB_SALPK ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi A (strain AKU_12601) GN=rhlB PE=3 SV=1 779 862 6.0E-11
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 792 864 6.0E-11
sp|A6VKC3|RHLB_ACTSZ ATP-dependent RNA helicase RhlB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rhlB PE=3 SV=1 752 861 6.0E-11
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 752 859 6.0E-11
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 753 855 6.0E-11
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 780 861 7.0E-11
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 753 859 7.0E-11
sp|B5XYY9|RHLB_KLEP3 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae (strain 342) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|A9MJ29|RHLB_SALAR ATP-dependent RNA helicase RhlB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 753 855 7.0E-11
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 806 864 7.0E-11
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|A8ACT3|RHLB_CITK8 ATP-dependent RNA helicase RhlB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 792 863 7.0E-11
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 752 866 7.0E-11
sp|Q3YVI4|RHLB_SHISS ATP-dependent RNA helicase RhlB OS=Shigella sonnei (strain Ss046) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|P0A8K0|RHLB_SHIFL ATP-dependent RNA helicase RhlB OS=Shigella flexneri GN=rhlB PE=3 SV=2 779 862 7.0E-11
sp|Q1R4F9|RHLB_ECOUT ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain UTI89 / UPEC) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B6I4B6|RHLB_ECOSE ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SE11) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|P0A8J8|RHLB_ECOLI ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12) GN=rhlB PE=1 SV=2 779 862 7.0E-11
sp|B1IWC0|RHLB_ECOLC ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|P0A8J9|RHLB_ECOL6 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhlB PE=3 SV=2 779 862 7.0E-11
sp|Q0TAU3|RHLB_ECOL5 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|A1AHV0|RHLB_ECOK1 ATP-dependent RNA helicase RhlB OS=Escherichia coli O1:K1 / APEC GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|A8A6N4|RHLB_ECOHS ATP-dependent RNA helicase RhlB OS=Escherichia coli O9:H4 (strain HS) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B1X9Z4|RHLB_ECODH ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / DH10B) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|C4ZZ48|RHLB_ECOBW ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B7M5C7|RHLB_ECO8A ATP-dependent RNA helicase RhlB OS=Escherichia coli O8 (strain IAI1) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B7MR01|RHLB_ECO81 ATP-dependent RNA helicase RhlB OS=Escherichia coli O81 (strain ED1a) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B7L8B6|RHLB_ECO55 ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain 55989 / EAEC) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B7MGJ1|RHLB_ECO45 ATP-dependent RNA helicase RhlB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B7UMN5|RHLB_ECO27 ATP-dependent RNA helicase RhlB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|A7ZTY2|RHLB_ECO24 ATP-dependent RNA helicase RhlB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|A7MQI2|RHLB_CROS8 ATP-dependent RNA helicase RhlB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|B5YY28|RHLB_ECO5E ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|Q93ZG7|RH38_ARATH DEAD-box ATP-dependent RNA helicase 38 OS=Arabidopsis thaliana GN=RH38 PE=1 SV=2 753 866 7.0E-11
sp|Q0SYX0|RHLB_SHIF8 ATP-dependent RNA helicase RhlB OS=Shigella flexneri serotype 5b (strain 8401) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 750 868 7.0E-11
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 753 859 7.0E-11
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 752 855 7.0E-11
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 752 861 7.0E-11
sp|B7LU75|RHLB_ESCF3 ATP-dependent RNA helicase RhlB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rhlB PE=3 SV=1 779 862 7.0E-11
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 750 868 8.0E-11
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 807 891 8.0E-11
sp|B7NF85|RHLB_ECOLU ATP-dependent RNA helicase RhlB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhlB PE=3 SV=1 779 862 8.0E-11
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 789 867 8.0E-11
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 789 867 8.0E-11
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 789 867 8.0E-11
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 789 867 8.0E-11
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 789 867 8.0E-11
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 789 867 8.0E-11
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 789 867 8.0E-11
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 789 867 8.0E-11
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 753 860 8.0E-11
sp|Q31UK5|RHLB_SHIBS ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 4 (strain Sb227) GN=rhlB PE=3 SV=1 779 862 8.0E-11
sp|B2TU12|RHLB_SHIB3 ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rhlB PE=3 SV=1 779 862 8.0E-11
sp|A2QWW0|MAK5_ASPNC ATP-dependent RNA helicase mak5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mak5 PE=3 SV=1 728 863 8.0E-11
sp|B7NTG2|RHLB_ECO7I ATP-dependent RNA helicase RhlB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhlB PE=3 SV=1 779 862 8.0E-11
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 753 860 8.0E-11
sp|Q40465|IF411_TOBAC Eukaryotic initiation factor 4A-11 OS=Nicotiana tabacum PE=2 SV=1 785 867 8.0E-11
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 753 859 8.0E-11
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 752 863 8.0E-11
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 787 855 8.0E-11
sp|B1LLV3|RHLB_ECOSM ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhlB PE=3 SV=1 779 862 8.0E-11
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 510 627 8.0E-11
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 792 864 9.0E-11
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 783 864 9.0E-11
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 752 859 9.0E-11
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 753 855 9.0E-11
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 753 859 9.0E-11
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 792 864 9.0E-11
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 753 883 9.0E-11
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 792 864 9.0E-11
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 787 855 9.0E-11
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 792 864 9.0E-11
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 752 916 1.0E-10
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 752 863 1.0E-10
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 779 862 1.0E-10
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 751 867 1.0E-10
sp|P41378|IF4A_WHEAT Eukaryotic initiation factor 4A OS=Triticum aestivum PE=2 SV=1 785 867 1.0E-10
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 789 867 1.0E-10
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 744 863 1.0E-10
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 792 864 1.0E-10
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 772 864 1.0E-10
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 753 867 1.0E-10
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 752 863 1.0E-10
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 780 859 1.0E-10
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 808 902 1.0E-10
sp|Q5K5B6|RH57_ORYSJ DEAD-box ATP-dependent RNA helicase 57 OS=Oryza sativa subsp. japonica GN=Os07g0647900 PE=2 SV=2 745 867 1.0E-10
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 752 861 1.0E-10
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 753 862 1.0E-10
sp|Q6LLL5|RHLB_PHOPR ATP-dependent RNA helicase RhlB OS=Photobacterium profundum GN=rhlB PE=3 SV=1 779 862 1.0E-10
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 808 864 1.0E-10
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 789 867 1.0E-10
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 530 651 1.0E-10
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 753 868 1.0E-10
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 789 867 1.0E-10
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 807 867 1.0E-10
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 789 867 1.0E-10
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 807 864 1.0E-10
sp|Q9Y2R4|DDX52_HUMAN Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens GN=DDX52 PE=1 SV=3 750 863 1.0E-10
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 807 891 1.0E-10
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 753 867 4.0E-10
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 531 671 5.0E-10
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 531 628 7.0E-10
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 337 571 8.0E-10
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 531 671 9.0E-10
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 339 571 2.0E-09
sp|A3LWH3|DBP7_PICST ATP-dependent RNA helicase DBP7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DPB7 PE=3 SV=2 339 464 1.0E-08
sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP7 PE=3 SV=3 339 464 1.0E-08
sp|A1CB55|DBP7_ASPCL ATP-dependent RNA helicase dbp7 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp7 PE=3 SV=1 339 464 1.0E-08
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 531 671 1.0E-08
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 791 859 1.0E-08
sp|A1DE84|DBP7_NEOFI ATP-dependent RNA helicase dbp7 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp7 PE=3 SV=1 339 464 2.0E-08
sp|Q4WV71|DBP7_ASPFU ATP-dependent RNA helicase dbp7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp7 PE=3 SV=1 339 464 2.0E-08
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 329 491 2.0E-08
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 531 678 4.0E-08
sp|Q5BGX6|DBP7_EMENI ATP-dependent RNA helicase dbp7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp7 PE=3 SV=1 301 464 7.0E-08
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 531 653 7.0E-08
sp|Q4HZ68|DBP7_GIBZE ATP-dependent RNA helicase DBP7 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP7 PE=3 SV=1 339 438 9.0E-08
sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 301 464 1.0E-07
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 322 432 1.0E-07
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 532 670 1.0E-07
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 531 672 2.0E-07
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 531 671 2.0E-07
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 532 624 2.0E-07
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 337 426 2.0E-07
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 339 458 2.0E-07
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 318 432 2.0E-07
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 292 464 3.0E-07
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 532 571 4.0E-07
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 339 460 4.0E-07
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 339 460 5.0E-07
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 532 571 5.0E-07
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 532 624 6.0E-07
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 532 571 6.0E-07
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 532 571 6.0E-07
sp|Q2GZU7|DBP7_CHAGB ATP-dependent RNA helicase DBP7 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP7 PE=3 SV=1 339 452 7.0E-07
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 339 468 7.0E-07
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 532 571 1.0E-06
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 532 571 1.0E-06
sp|Q6C835|DBP7_YARLI ATP-dependent RNA helicase DBP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP7 PE=3 SV=1 339 464 1.0E-06
sp|Q0CMB0|ROK1_ASPTN ATP-dependent RNA helicase rok1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rok1 PE=3 SV=2 257 589 1.0E-06
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 532 571 1.0E-06
sp|Q1E306|ROK1_COCIM ATP-dependent RNA helicase ROK1 OS=Coccidioides immitis (strain RS) GN=ROK1 PE=3 SV=1 352 589 1.0E-06
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 339 464 1.0E-06
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 333 432 1.0E-06
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 337 571 1.0E-06
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 352 464 2.0E-06
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 532 667 2.0E-06
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 532 624 2.0E-06
sp|P34668|YO12_CAEEL Putative ATP-dependent RNA helicase ZK686.2 OS=Caenorhabditis elegans GN=ZK686.2 PE=3 SV=2 356 432 2.0E-06
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 339 427 2.0E-06
sp|Q9Y2R4|DDX52_HUMAN Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens GN=DDX52 PE=1 SV=3 356 428 2.0E-06
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 532 624 3.0E-06
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 337 432 3.0E-06
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 335 671 3.0E-06
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 339 464 3.0E-06
sp|P0CR06|DBP10_CRYNJ ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP10 PE=3 SV=1 322 436 4.0E-06
sp|P0CR07|DBP10_CRYNB ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP10 PE=3 SV=1 322 436 4.0E-06
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 339 464 4.0E-06
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 339 433 4.0E-06
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 333 464 5.0E-06
sp|Q7S873|DBP7_NEUCR ATP-dependent RNA helicase dbp-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-7 PE=3 SV=1 339 452 6.0E-06
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 332 464 6.0E-06
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 339 427 6.0E-06
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 339 427 6.0E-06
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 337 432 7.0E-06
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 339 431 7.0E-06
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 339 431 7.0E-06
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 339 467 8.0E-06
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 332 467 8.0E-06
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 339 432 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2108
MYARYVPPPKASKAAAPGAAASAARPVENAPSADQSAPPALAPPADGFSYARYVPGAQAAKAPKIQYFEDESGAP
NPKRKRESADEPPASSQLGSKKAKTRGGHDGVTSTETRERLEPSGDQEAGQKKKKNRRKRKQRTKADDDDDHSQD
SEEEPSLSKRAPLEPSSEEDVAPPTVAARDEKPEQPRPKMESEGTVLETVRTESTPETKDGDVDMVDAKVPAPET
ESAPLSASQGPEEKRGKKDRKKKQEKQQIDVGGEGEELRHKVVLERKAKSLRFASKATQGETLEPGEEPAERHDL
DPLPQPAVVPDNETKPTYDTLPSWLARPIRVTQETRKPFGELGVLPRSARFLEQKGFSEAFAVQTAAIPLLLPTS
AHRPGDVLISAATGSGKTLAYALPIVRDIGQGAVTRLRALVVLPTRELVKQAQDVFEICARAYDGEERKKVRIGV
AVGSQSIKTEQLKLVASESRYDPEAYRQIEGEAKDRKHGLGTSRPDGDNDSLDPGADSAGGKDPRLGAWEGEVVD
FSSMVDVLICTPGRLVEHVEQTAGFSLDHVRWLVVDEADKLLAQSFQGWLGVVMGRFRASSFGARDFPDMEYAGV
RKVILSATLTRDLSLLGQLELRRPRLIVLEGEGEGANAGAAEHTLPTSLREFAVRVHEPSLKPLYLLRLLRGQHM
TRAGLSTGDDAMASKQEDASDSDSDSGSGPDSSESTSDSTSDSESDSDTSSAGSSTAGASEPEASASGAAESRLP
HCLIFTKSNESALRLARLLVLLDASLTTRVSTLTSTTATHARRKTLRAFTTASSPVRLVIASDLVARGIDIPRLG
HVVNYDLPASVAGYVHRVGRTARAGRDGCAWTLVADDESGWFWGKIAKGRGVRRAQRVERTRIDEMGEEQTKQYE
EALAKLGREALEMKRG*
Coding >Hirsu2|2108
ATGTACGCGAGATACGTCCCCCCGCCGAAGGCCTCCAAAGCCGCCGCTCCGGGCGCCGCCGCCTCCGCAGCGCGG
CCCGTCGAGAACGCGCCATCGGCCGACCAGTCTGCGCCTCCGGCCCTTGCGCCACCGGCCGACGGCTTCAGCTAC
GCTCGCTACGTCCCGGGAGCTCAAGCGGCCAAAGCGCCCAAAATTCAATACTTCGAAGACGAATCCGGCGCGCCG
AACCCCAAGCGGAAGCGAGAGAGTGCGGACGAACCTCCGGCGAGCAGCCAGCTGGGAAGCAAGAAAGCCAAGACG
CGCGGAGGGCACGATGGAGTGACGAGCACGGAGACCAGGGAGAGGCTGGAGCCGTCAGGCGATCAAGAAGCTGGG
CAGAAGAAGAAGAAAAATAGGAGAAAGCGCAAGCAGAGAACCAAGGCCGACGACGACGATGATCACTCGCAAGAT
TCCGAAGAGGAGCCGTCTCTCTCCAAGCGTGCCCCGTTAGAGCCCTCATCAGAAGAAGACGTGGCGCCTCCGACA
GTTGCTGCAAGGGACGAAAAACCGGAGCAGCCAAGACCCAAGATGGAGTCTGAAGGAACGGTGCTCGAAACGGTG
CGGACCGAGAGCACACCAGAAACGAAAGACGGTGATGTCGACATGGTAGACGCGAAAGTGCCGGCGCCAGAAACG
GAAAGCGCTCCGCTGTCGGCGTCGCAAGGTCCCGAAGAGAAGAGGGGGAAAAAGGATAGGAAGAAGAAGCAAGAA
AAACAACAGATCGACGTTGGCGGGGAAGGAGAGGAATTGCGCCACAAGGTGGTCCTCGAGCGAAAAGCAAAGTCG
CTGAGGTTTGCCAGCAAGGCCACGCAAGGTGAGACCCTGGAGCCCGGGGAGGAGCCAGCGGAACGGCACGACCTG
GATCCTCTACCGCAACCAGCCGTTGTGCCCGACAACGAGACGAAACCAACGTACGACACCCTCCCGTCTTGGCTG
GCAAGGCCCATCCGCGTCACGCAAGAAACCCGAAAACCGTTCGGCGAGCTGGGCGTCCTCCCCAGATCGGCCCGC
TTTTTGGAGCAAAAAGGCTTCTCCGAAGCATTTGCCGTCCAGACCGCCGCGATACCGCTGCTACTGCCCACAAGC
GCGCACCGCCCCGGAGACGTCCTCATCTCCGCCGCGACCGGCTCGGGCAAGACGTTGGCCTACGCGCTGCCCATC
GTGCGCGACATCGGCCAGGGCGCCGTGACGCGGCTGCGCGCGCTCGTGGTCTTGCCGACGCGCGAGCTCGTGAAG
CAGGCGCAGGACGTCTTTGAGATTTGCGCCCGGGCCTACGACGGCGAGGAGCGGAAGAAGGTGCGGATCGGCGTC
GCCGTCGGCAGCCAGTCCATCAAGACGGAGCAGCTCAAGTTGGTGGCGAGCGAGTCGCGGTACGACCCGGAGGCT
TACAGGCAGATCGAAGGGGAAGCAAAGGACCGGAAACATGGGCTTGGGACGTCACGGCCGGACGGCGACAACGAC
TCGCTTGACCCCGGGGCGGACTCGGCGGGCGGAAAGGACCCCAGGCTCGGCGCGTGGGAGGGTGAGGTGGTGGAT
TTCTCGTCCATGGTCGATGTCCTGATCTGCACGCCGGGGCGACTGGTGGAGCACGTGGAACAGACGGCCGGCTTC
AGCCTCGACCACGTCCGCTGGCTGGTCGTGGACGAGGCCGACAAGCTCCTGGCGCAGAGCTTCCAGGGCTGGCTG
GGTGTCGTCATGGGCCGGTTCCGCGCGAGCAGCTTCGGCGCCCGGGACTTCCCCGACATGGAGTACGCGGGGGTG
CGCAAGGTGATCCTGAGCGCGACGCTGACGAGGGACCTGAGCCTCCTGGGCCAGCTGGAGCTGCGCCGGCCCCGG
CTCATCGTGCTCGAGGGCGAGGGCGAGGGCGCCAACGCGGGCGCGGCCGAGCACACGCTCCCGACGTCGCTCAGG
GAGTTTGCCGTCCGGGTCCACGAGCCGAGCCTCAAGCCGCTGTACCTCTTGCGTCTCCTTCGAGGCCAGCACATG
ACGAGGGCGGGGCTGTCGACAGGGGACGACGCGATGGCGTCGAAGCAAGAGGACGCGTCGGACTCGGACTCGGAC
TCCGGTTCGGGTCCGGATTCGTCCGAATCTACGTCGGACTCGACCTCCGACTCCGAGTCGGACAGCGACACCAGC
TCGGCAGGCAGCTCAACCGCGGGCGCGTCGGAGCCCGAGGCGTCGGCGTCCGGCGCGGCCGAGTCGCGCCTGCCG
CACTGCCTCATCTTCACCAAGTCCAACGAGTCGGCGCTGCGGCTGGCGCGGCTGCTGGTGCTCCTGGACGCGTCG
CTGACGACGCGCGTCAGCACGCTGACGTCGACGACGGCGACGCACGCCCGGCGCAAGACGCTGCGGGCCTTTACG
ACGGCGTCGTCGCCGGTGCGGCTGGTCATCGCGTCCGACCTGGTGGCGCGCGGCATCGACATCCCGCGGCTGGGC
CACGTCGTCAACTACGACCTGCCGGCGAGCGTGGCCGGCTACGTCCACCGCGTCGGCCGCACGGCGCGGGCGGGG
CGCGACGGCTGCGCGTGGACCCTCGTCGCCGACGACGAGAGCGGCTGGTTCTGGGGCAAGATCGCCAAGGGCCGC
GGCGTGCGGCGGGCGCAGAGGGTGGAGAGGACGCGCATCGACGAGATGGGCGAGGAGCAGACGAAGCAGTACGAA
GAGGCACTGGCCAAGCTCGGCAGAGAGGCTCTCGAGATGAAGAGAGGTTGA
Transcript >Hirsu2|2108
ATGTACGCGAGATACGTCCCCCCGCCGAAGGCCTCCAAAGCCGCCGCTCCGGGCGCCGCCGCCTCCGCAGCGCGG
CCCGTCGAGAACGCGCCATCGGCCGACCAGTCTGCGCCTCCGGCCCTTGCGCCACCGGCCGACGGCTTCAGCTAC
GCTCGCTACGTCCCGGGAGCTCAAGCGGCCAAAGCGCCCAAAATTCAATACTTCGAAGACGAATCCGGCGCGCCG
AACCCCAAGCGGAAGCGAGAGAGTGCGGACGAACCTCCGGCGAGCAGCCAGCTGGGAAGCAAGAAAGCCAAGACG
CGCGGAGGGCACGATGGAGTGACGAGCACGGAGACCAGGGAGAGGCTGGAGCCGTCAGGCGATCAAGAAGCTGGG
CAGAAGAAGAAGAAAAATAGGAGAAAGCGCAAGCAGAGAACCAAGGCCGACGACGACGATGATCACTCGCAAGAT
TCCGAAGAGGAGCCGTCTCTCTCCAAGCGTGCCCCGTTAGAGCCCTCATCAGAAGAAGACGTGGCGCCTCCGACA
GTTGCTGCAAGGGACGAAAAACCGGAGCAGCCAAGACCCAAGATGGAGTCTGAAGGAACGGTGCTCGAAACGGTG
CGGACCGAGAGCACACCAGAAACGAAAGACGGTGATGTCGACATGGTAGACGCGAAAGTGCCGGCGCCAGAAACG
GAAAGCGCTCCGCTGTCGGCGTCGCAAGGTCCCGAAGAGAAGAGGGGGAAAAAGGATAGGAAGAAGAAGCAAGAA
AAACAACAGATCGACGTTGGCGGGGAAGGAGAGGAATTGCGCCACAAGGTGGTCCTCGAGCGAAAAGCAAAGTCG
CTGAGGTTTGCCAGCAAGGCCACGCAAGGTGAGACCCTGGAGCCCGGGGAGGAGCCAGCGGAACGGCACGACCTG
GATCCTCTACCGCAACCAGCCGTTGTGCCCGACAACGAGACGAAACCAACGTACGACACCCTCCCGTCTTGGCTG
GCAAGGCCCATCCGCGTCACGCAAGAAACCCGAAAACCGTTCGGCGAGCTGGGCGTCCTCCCCAGATCGGCCCGC
TTTTTGGAGCAAAAAGGCTTCTCCGAAGCATTTGCCGTCCAGACCGCCGCGATACCGCTGCTACTGCCCACAAGC
GCGCACCGCCCCGGAGACGTCCTCATCTCCGCCGCGACCGGCTCGGGCAAGACGTTGGCCTACGCGCTGCCCATC
GTGCGCGACATCGGCCAGGGCGCCGTGACGCGGCTGCGCGCGCTCGTGGTCTTGCCGACGCGCGAGCTCGTGAAG
CAGGCGCAGGACGTCTTTGAGATTTGCGCCCGGGCCTACGACGGCGAGGAGCGGAAGAAGGTGCGGATCGGCGTC
GCCGTCGGCAGCCAGTCCATCAAGACGGAGCAGCTCAAGTTGGTGGCGAGCGAGTCGCGGTACGACCCGGAGGCT
TACAGGCAGATCGAAGGGGAAGCAAAGGACCGGAAACATGGGCTTGGGACGTCACGGCCGGACGGCGACAACGAC
TCGCTTGACCCCGGGGCGGACTCGGCGGGCGGAAAGGACCCCAGGCTCGGCGCGTGGGAGGGTGAGGTGGTGGAT
TTCTCGTCCATGGTCGATGTCCTGATCTGCACGCCGGGGCGACTGGTGGAGCACGTGGAACAGACGGCCGGCTTC
AGCCTCGACCACGTCCGCTGGCTGGTCGTGGACGAGGCCGACAAGCTCCTGGCGCAGAGCTTCCAGGGCTGGCTG
GGTGTCGTCATGGGCCGGTTCCGCGCGAGCAGCTTCGGCGCCCGGGACTTCCCCGACATGGAGTACGCGGGGGTG
CGCAAGGTGATCCTGAGCGCGACGCTGACGAGGGACCTGAGCCTCCTGGGCCAGCTGGAGCTGCGCCGGCCCCGG
CTCATCGTGCTCGAGGGCGAGGGCGAGGGCGCCAACGCGGGCGCGGCCGAGCACACGCTCCCGACGTCGCTCAGG
GAGTTTGCCGTCCGGGTCCACGAGCCGAGCCTCAAGCCGCTGTACCTCTTGCGTCTCCTTCGAGGCCAGCACATG
ACGAGGGCGGGGCTGTCGACAGGGGACGACGCGATGGCGTCGAAGCAAGAGGACGCGTCGGACTCGGACTCGGAC
TCCGGTTCGGGTCCGGATTCGTCCGAATCTACGTCGGACTCGACCTCCGACTCCGAGTCGGACAGCGACACCAGC
TCGGCAGGCAGCTCAACCGCGGGCGCGTCGGAGCCCGAGGCGTCGGCGTCCGGCGCGGCCGAGTCGCGCCTGCCG
CACTGCCTCATCTTCACCAAGTCCAACGAGTCGGCGCTGCGGCTGGCGCGGCTGCTGGTGCTCCTGGACGCGTCG
CTGACGACGCGCGTCAGCACGCTGACGTCGACGACGGCGACGCACGCCCGGCGCAAGACGCTGCGGGCCTTTACG
ACGGCGTCGTCGCCGGTGCGGCTGGTCATCGCGTCCGACCTGGTGGCGCGCGGCATCGACATCCCGCGGCTGGGC
CACGTCGTCAACTACGACCTGCCGGCGAGCGTGGCCGGCTACGTCCACCGCGTCGGCCGCACGGCGCGGGCGGGG
CGCGACGGCTGCGCGTGGACCCTCGTCGCCGACGACGAGAGCGGCTGGTTCTGGGGCAAGATCGCCAAGGGCCGC
GGCGTGCGGCGGGCGCAGAGGGTGGAGAGGACGCGCATCGACGAGATGGGCGAGGAGCAGACGAAGCAGTACGAA
GAGGCACTGGCCAAGCTCGGCAGAGAGGCTCTCGAGATGAAGAGAGGTTGA
Gene >Hirsu2|2108
ATGTACGCGAGATACGTCCCCCCGCCGAAGGCCTCCAAAGCCGCCGCTCCGGGCGCCGCCGCCTCCGCAGCGCGG
CCCGTCGAGAACGCGCCATCGGCCGACCAGTCTGCGCCTCCGGCCCTTGCGCCACCGGCCGACGGCTTCAGCTAC
GCTCGCTACGTCCCGGGAGCTCAAGCGGCCAAAGCGCCCAAAATTCAATACTTCGAAGACGAATCCGGCGCGCCG
AACCCCAAGCGGAAGCGAGAGAGTGCGGACGAACCTCCGGCGAGCAGCCAGCTGGGAAGCAAGAAAGCCAAGACG
CGCGGAGGGCACGATGGAGTGACGAGCACGGAGACCAGGGAGAGGCTGGAGCCGTCAGGCGATCAAGAAGCTGGG
CAGAAGAAGAAGAAAAATAGGAGAAAGCGCAAGCAGAGAACCAAGGCCGACGACGACGATGATCACTCGCAAGAT
TCCGAAGAGGAGCCGTCTCTCTCCAAGCGTGCCCCGTTAGAGCCCTCATCAGAAGAAGACGTGGCGCCTCCGACA
GTTGCTGCAAGGGACGAAAAACCGGAGCAGCCAAGACCCAAGATGGAGTCTGAAGGAACGGTGCTCGAAACGGTG
CGGACCGAGAGCACACCAGAAACGAAAGACGGTGATGTCGACATGGTAGACGCGAAAGTGCCGGCGCCAGAAACG
GAAAGCGCTCCGCTGTCGGCGTCGCAAGGTCCCGAAGAGAAGAGGGGGAAAAAGGATAGGAAGAAGAAGCAAGAA
AAACAACAGATCGACGTTGGCGGGGAAGGAGAGGAATTGCGCCACAAGGTGGTCCTCGAGCGAAAAGCAAAGTCG
CTGAGGTTTGCCAGCAAGGCCACGCAAGGTGAGACCCTGGAGCCCGGGGAGGAGCCAGCGGAACGGCACGACCTG
GATCCTCTACCGCAACCAGCCGTTGTGCCCGACAACGAGACGAAACCAACGTACGACACCCTCCCGTCTTGGCTG
GCAAGGCCCATCCGCGTCACGCAAGAAACCCGAAAACCGTTCGGCGAGCTGGGCGTCCTCCCCAGATCGGCCCGC
TTTTTGGAGCAAAAAGGCTTCTCCGAAGCATTTGCCGTCCAGACCGCCGCGATACCGCTGCTACTGCCCACAAGC
GCGCACCGCCCCGGAGACGTCCTCATCTCCGCCGCGACCGGCTCGGGCAAGACGTTGGCCTACGCGCTGCCCATC
GTGCGCGACATCGGCCAGGGCGCCGTGACGCGGCTGCGCGCGCTCGTGGTCTTGCCGACGCGCGAGCTCGTGAAG
CAGGCGCAGGACGTCTTTGAGATTTGCGCCCGGGCCTACGACGGCGAGGAGCGGAAGAAGGTGCGGATCGGCGTC
GCCGTCGGCAGCCAGTCCATCAAGACGGAGCAGCTCAAGTTGGTGGCGAGCGAGTCGCGGTACGACCCGGAGGCT
TACAGGCAGATCGAAGGGGAAGCAAAGGACCGGAAACATGGGCTTGGGACGTCACGGCCGGACGGCGACAACGAC
TCGCTTGACCCCGGGGCGGACTCGGCGGGCGGAAAGGACCCCAGGCTCGGCGCGTGGGAGGGTGAGGTGGTGGAT
TTCTCGTCCATGGTCGATGTCCTGATCTGCACGCCGGGGCGACTGGTGGAGCACGTGGAACAGACGGCCGGCTTC
AGCCTCGACCACGTCCGCTGGCTGGTCGTGGACGAGGCCGACAAGCTCCTGGCGCAGAGCTTCCAGGGCTGGCTG
GGTGTCGTCATGGGCCGGTTCCGCGCGAGCAGCTTCGGCGCCCGGGACTTCCCCGACATGGAGTACGCGGGGGTG
CGCAAGGTGATCCTGAGCGCGACGCTGACGAGGGACCTGAGCCTCCTGGGCCAGCTGGAGCTGCGCCGGCCCCGG
CTCATCGTGCTCGAGGGCGAGGGCGAGGGCGCCAACGCGGGCGCGGCCGAGCACACGCTCCCGACGTCGCTCAGG
GAGTTTGCCGTCCGGGTCCACGAGCCGAGCCTCAAGCCGCTGTACCTCTTGCGTCTCCTTCGAGGCCAGCACATG
ACGAGGGCGGGGCTGTCGACAGGGGACGACGCGATGGCGTCGAAGCAAGAGGACGCGTCGGACTCGGACTCGGAC
TCCGGTTCGGGTCCGGATTCGTCCGAATCTACGTCGGACTCGACCTCCGACTCCGAGTCGGACAGCGACACCAGC
TCGGCAGGCAGCTCAACCGCGGGCGCGTCGGAGCCCGAGGCGTCGGCGTCCGGCGCGGCCGAGTCGCGCCTGCCG
CACTGCCTCATCTTCACCAAGTCCAACGAGTCGGCGCTGCGGCTGGCGCGGCTGCTGGTGCTCCTGGACGCGTCG
CTGACGACGCGCGTCAGCACGCTGACGTCGACGACGGCGACGCACGCCCGGCGCAAGACGCTGCGGGCCTTTACG
ACGGCGTCGTCGCCGGTGCGGCTGGTCATCGCGTCCGACCTGGTGGCGCGCGGCATCGACATCCCGCGGCTGGGC
CACGTCGTCAACTACGACCTGCCGGCGAGCGTGGCCGGCTACGTCCACCGCGTCGGCCGCACGGCGCGGGCGGGG
CGCGACGGCTGCGCGTGGACCCTCGTCGCCGACGACGAGAGCGGCTGGTTCTGGGGCAAGATCGCCAAGGGCCGC
GGCGTGCGGCGGGCGCAGAGGGTGGAGAGGACGCGCATCGACGAGATGGGCGAGGAGCAGACGAAGCAGTACGAA
GAGGCACTGGCCAAGCTCGGCAGAGAGGCTCTCGAGATGAAGAGAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail