Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2106
Gene name
LocationContig_1490:3968..6190
Strand-
Gene length (bp)2222
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07576 BRAP2 BRCA1-associated protein 2 8.6E-29 243 332
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 4.0E-18 443 501
PF13639 zf-RING_2 Ring finger domain 4.7E-09 374 414
PF17123 zf-RING_11 RING-like zinc finger 6.6E-07 375 402
PF13445 zf-RING_UBOX RING-type zinc-finger 7.2E-05 375 405
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.5E-05 375 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 177 715 3.0E-101
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 206 713 1.0E-77
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 204 708 2.0E-72
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 204 709 3.0E-71
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 204 720 3.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 177 715 3.0E-101
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 206 713 1.0E-77
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 204 708 2.0E-72
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 204 709 3.0E-71
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 204 720 3.0E-67
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 443 512 6.0E-08
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 443 512 1.0E-07
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 443 500 1.0E-07
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 443 500 4.0E-07
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 443 500 6.0E-07
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 443 515 7.0E-07
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 443 500 7.0E-07
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 443 502 9.0E-07
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 437 531 9.0E-07
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 437 500 2.0E-06
sp|P38237|UBP14_YEAST Ubiquitin carboxyl-terminal hydrolase 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP14 PE=1 SV=2 432 497 2.0E-06
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 331 441 4.0E-06
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 434 477 8.0E-06
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 325 441 8.0E-06
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 434 477 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2106
MPSYYYHLKFELYSTANPTESAKPAVPGSGSSRIWLPATDASVFDDLPSHPPPDRPRSREDQAPSARGKTTGAAQ
STDAARQEEARRDRNRSVIDCGAPRAPARDGEQKKIELLSERQWQDRARSSPAPTPAPGAAIRPRTAVQDWRFGR
VSIETVDPAARANAMAEEASRAAGPLAAPALGPSFGGAGTATKADCLPLDMKHTELGWGVVHFYRDGEETPSLNA
PDPHEDGPERGEASTADPCSTLCIPAVPAYMSPGDFMGFVGDRWMGDISHCRMVMTSRMNRYLVLLKFRDGSRAK
QWKGEFDGRVFNSMESQVCHVVFVKSITFETPGRSRRNDHPAAAAAASSSSSSAVSNSLKPFPPPPPNLIELPTC
PVCLERMDETNGLMTIPCSHVFHCACLQNWKGSGCPVCRFTNASSQMGAVDANNPYSQPFGSPVSNMCSVCDCTD
DLWICLICGYVGCGRYKGGHAKDHWKETAHSFALELETQHVWDYAGDMWVHRLIRDKGDGKVVELPGRGNHGGQG
DEDVVPRAKLENIGLEYTHLITSQLESQRAYYEEMISKAVDKAAKATAVAESSAAQSAETRERLAALEDRHRTLS
ADTLPQLERELEREKKKAGRAETLARGLGQALQEEKRLNEGLMKRIEHLGADGAAVREELSALKEENAELKEMNR
DLSMFISGQEKLKELEREGKVEEGEVAEGSMSVPEKKGRRRARKK*
Coding >Hirsu2|2106
ATGCCTTCGTACTACTATCATCTGAAGTTCGAGCTCTACTCTACCGCAAACCCCACCGAGAGTGCGAAGCCGGCG
GTCCCAGGCTCGGGCAGCAGTCGCATTTGGCTACCCGCGACCGACGCCAGCGTGTTCGACGACTTGCCCAGCCAC
CCGCCACCGGACCGACCGAGGTCACGAGAAGACCAGGCGCCGAGTGCTCGCGGAAAAACGACGGGCGCCGCCCAG
TCCACGGACGCGGCGAGGCAGGAGGAGGCCCGGCGAGACCGGAACCGAAGCGTCATCGACTGCGGCGCACCGCGA
GCGCCCGCCCGAGACGGCGAGCAGAAGAAGATCGAGCTGCTCTCGGAGAGGCAGTGGCAGGACCGTGCCAGGAGC
TCTCCAGCGCCGACGCCCGCGCCCGGCGCCGCCATACGACCGCGGACCGCCGTCCAGGACTGGCGGTTCGGCCGC
GTGAGCATCGAGACGGTGGACCCGGCCGCCCGCGCCAACGCCATGGCAGAGGAGGCGAGCAGGGCGGCAGGTCCC
CTGGCCGCGCCGGCTCTGGGGCCGTCCTTCGGCGGCGCCGGCACGGCGACCAAGGCCGACTGCCTGCCGCTCGAT
ATGAAGCATACGGAGCTCGGCTGGGGCGTCGTCCACTTCTACCGAGACGGCGAGGAGACGCCGTCGCTCAACGCA
CCGGACCCGCACGAGGACGGACCCGAGCGCGGCGAGGCCTCGACCGCGGACCCCTGCAGCACACTGTGCATACCG
GCCGTGCCGGCCTACATGTCGCCGGGGGACTTTATGGGCTTCGTCGGCGATCGCTGGATGGGAGACATCAGCCAC
TGTCGGATGGTCATGACCTCGAGGATGAACCGATACCTCGTCCTGCTCAAGTTCCGGGACGGCAGCCGAGCCAAG
CAGTGGAAAGGCGAGTTCGACGGCAGGGTGTTCAACTCTATGGAGTCCCAAGTTTGCCACGTCGTCTTCGTCAAG
TCCATTACCTTTGAGACGCCCGGCAGGTCGCGCCGAAACGACCACCCGGCGGCGGCGGCGGCTGCGTCGTCGTCT
TCGTCGTCGGCCGTTTCCAACAGCCTCAAGCCGTTCCCGCCTCCGCCGCCCAACCTCATCGAACTCCCGACCTGC
CCCGTGTGCCTGGAGAGGATGGACGAGACCAATGGGCTGATGACGATACCCTGTTCCCACGTTTTTCACTGCGCC
TGCCTTCAGAACTGGAAAGGTTCGGGATGCCCGGTCTGCCGATTCACAAACGCCTCGTCGCAGATGGGCGCCGTC
GACGCCAACAACCCGTACTCGCAGCCGTTCGGGTCGCCCGTGTCCAACATGTGCAGCGTGTGCGACTGCACGGAC
GACCTCTGGATCTGCCTCATCTGCGGCTACGTCGGCTGCGGCCGCTACAAGGGCGGCCACGCCAAGGACCACTGG
AAGGAGACGGCGCACAGCTTCGCCCTGGAGCTCGAGACGCAGCACGTCTGGGACTACGCCGGGGACATGTGGGTG
CACCGCCTGATCCGCGACAAGGGCGACGGCAAGGTCGTCGAGCTGCCCGGCCGGGGCAACCACGGCGGGCAGGGC
GACGAGGACGTGGTGCCGCGGGCCAAGCTGGAGAACATCGGGCTCGAGTACACGCACCTGATTACGAGCCAGCTC
GAGTCGCAGCGGGCCTACTACGAGGAGATGATCAGCAAGGCGGTCGACAAGGCGGCCAAGGCGACGGCCGTGGCG
GAGAGCAGCGCCGCGCAGTCGGCCGAGACGAGGGAGCGGCTCGCGGCGCTCGAGGACAGGCACAGGACGCTCAGC
GCCGACACGCTCCCGCAGCTCGAGCGCGAGCTGGAGCGGGAGAAGAAGAAGGCGGGCCGGGCGGAGACGCTGGCG
CGCGGCCTGGGCCAGGCGCTGCAGGAGGAGAAGCGGCTGAACGAGGGCCTCATGAAGCGCATCGAGCACCTGGGC
GCGGACGGCGCGGCGGTGCGGGAGGAGCTCTCGGCGCTCAAGGAGGAGAACGCGGAGCTCAAGGAGATGAACCGC
GACCTGTCCATGTTCATCTCCGGGCAGGAGAAGCTCAAGGAGCTGGAGCGGGAGGGCAAGGTGGAGGAGGGGGAG
GTTGCCGAGGGGAGCATGAGCGTGCCGGAGAAGAAGGGCCGGAGAAGGGCGCGCAAGAAGTGA
Transcript >Hirsu2|2106
ATGCCTTCGTACTACTATCATCTGAAGTTCGAGCTCTACTCTACCGCAAACCCCACCGAGAGTGCGAAGCCGGCG
GTCCCAGGCTCGGGCAGCAGTCGCATTTGGCTACCCGCGACCGACGCCAGCGTGTTCGACGACTTGCCCAGCCAC
CCGCCACCGGACCGACCGAGGTCACGAGAAGACCAGGCGCCGAGTGCTCGCGGAAAAACGACGGGCGCCGCCCAG
TCCACGGACGCGGCGAGGCAGGAGGAGGCCCGGCGAGACCGGAACCGAAGCGTCATCGACTGCGGCGCACCGCGA
GCGCCCGCCCGAGACGGCGAGCAGAAGAAGATCGAGCTGCTCTCGGAGAGGCAGTGGCAGGACCGTGCCAGGAGC
TCTCCAGCGCCGACGCCCGCGCCCGGCGCCGCCATACGACCGCGGACCGCCGTCCAGGACTGGCGGTTCGGCCGC
GTGAGCATCGAGACGGTGGACCCGGCCGCCCGCGCCAACGCCATGGCAGAGGAGGCGAGCAGGGCGGCAGGTCCC
CTGGCCGCGCCGGCTCTGGGGCCGTCCTTCGGCGGCGCCGGCACGGCGACCAAGGCCGACTGCCTGCCGCTCGAT
ATGAAGCATACGGAGCTCGGCTGGGGCGTCGTCCACTTCTACCGAGACGGCGAGGAGACGCCGTCGCTCAACGCA
CCGGACCCGCACGAGGACGGACCCGAGCGCGGCGAGGCCTCGACCGCGGACCCCTGCAGCACACTGTGCATACCG
GCCGTGCCGGCCTACATGTCGCCGGGGGACTTTATGGGCTTCGTCGGCGATCGCTGGATGGGAGACATCAGCCAC
TGTCGGATGGTCATGACCTCGAGGATGAACCGATACCTCGTCCTGCTCAAGTTCCGGGACGGCAGCCGAGCCAAG
CAGTGGAAAGGCGAGTTCGACGGCAGGGTGTTCAACTCTATGGAGTCCCAAGTTTGCCACGTCGTCTTCGTCAAG
TCCATTACCTTTGAGACGCCCGGCAGGTCGCGCCGAAACGACCACCCGGCGGCGGCGGCGGCTGCGTCGTCGTCT
TCGTCGTCGGCCGTTTCCAACAGCCTCAAGCCGTTCCCGCCTCCGCCGCCCAACCTCATCGAACTCCCGACCTGC
CCCGTGTGCCTGGAGAGGATGGACGAGACCAATGGGCTGATGACGATACCCTGTTCCCACGTTTTTCACTGCGCC
TGCCTTCAGAACTGGAAAGGTTCGGGATGCCCGGTCTGCCGATTCACAAACGCCTCGTCGCAGATGGGCGCCGTC
GACGCCAACAACCCGTACTCGCAGCCGTTCGGGTCGCCCGTGTCCAACATGTGCAGCGTGTGCGACTGCACGGAC
GACCTCTGGATCTGCCTCATCTGCGGCTACGTCGGCTGCGGCCGCTACAAGGGCGGCCACGCCAAGGACCACTGG
AAGGAGACGGCGCACAGCTTCGCCCTGGAGCTCGAGACGCAGCACGTCTGGGACTACGCCGGGGACATGTGGGTG
CACCGCCTGATCCGCGACAAGGGCGACGGCAAGGTCGTCGAGCTGCCCGGCCGGGGCAACCACGGCGGGCAGGGC
GACGAGGACGTGGTGCCGCGGGCCAAGCTGGAGAACATCGGGCTCGAGTACACGCACCTGATTACGAGCCAGCTC
GAGTCGCAGCGGGCCTACTACGAGGAGATGATCAGCAAGGCGGTCGACAAGGCGGCCAAGGCGACGGCCGTGGCG
GAGAGCAGCGCCGCGCAGTCGGCCGAGACGAGGGAGCGGCTCGCGGCGCTCGAGGACAGGCACAGGACGCTCAGC
GCCGACACGCTCCCGCAGCTCGAGCGCGAGCTGGAGCGGGAGAAGAAGAAGGCGGGCCGGGCGGAGACGCTGGCG
CGCGGCCTGGGCCAGGCGCTGCAGGAGGAGAAGCGGCTGAACGAGGGCCTCATGAAGCGCATCGAGCACCTGGGC
GCGGACGGCGCGGCGGTGCGGGAGGAGCTCTCGGCGCTCAAGGAGGAGAACGCGGAGCTCAAGGAGATGAACCGC
GACCTGTCCATGTTCATCTCCGGGCAGGAGAAGCTCAAGGAGCTGGAGCGGGAGGGCAAGGTGGAGGAGGGGGAG
GTTGCCGAGGGGAGCATGAGCGTGCCGGAGAAGAAGGGCCGGAGAAGGGCGCGCAAGAAGTGA
Gene >Hirsu2|2106
ATGCCTTCGTACTACTATCATCTGAAGTTCGAGCTCTACTCTACCGCAAACCCCACCGAGAGTGCGAAGCCGGCG
GTCCCAGGCTCGGGCAGCAGTCGCATTTGGCTACCCGCGACCGACGCCAGCGTGTTCGACGACTTGCCCAGCCAC
CCGCCACCGGACCGACCGAGGTCACGAGAAGACCAGGCGCCGAGTGCTCGCGGAAAAACGACGGGCGCCGCCCAG
TCCACGGACGCGGCGAGGCAGGAGGAGGCCCGGCGAGACCGGAACCGAAGCGTCATCGACTGCGGCGCACCGCGA
GCGCCCGCCCGAGACGGCGAGCAGAAGAAGATCGAGCTGCTCTCGGAGAGGCAGTGGCAGGACCGTGCCAGGAGC
TCTCCAGCGCCGACGCCCGCGCCCGGCGCCGCCATACGACCGCGGACCGCCGTCCAGGACTGGCGGTTCGGCCGC
GTGAGCATCGAGACGGTGGACCCGGCCGCCCGCGCCAACGCCATGGCAGAGGAGGCGAGCAGGGCGGCAGGTCCC
CTGGCCGCGCCGGCTCTGGGGCCGTCCTTCGGCGGCGCCGGCACGGCGACCAAGGCCGACTGCCTGCCGCTCGAT
ATGAAGCATACGGAGCTCGGCTGGGGCGTCGTCCACTTCTACCGAGACGGCGAGGAGACGCCGTCGCTCAACGCA
CCGGACCCGCACGAGGACGGACCCGAGCGCGGCGAGGCCTCGACCGCGGACCCCTGCAGCACACTGTGCATACCG
GCCGTGCCGGCCTACATGTCGCCGGGGGACTTTATGGGCTTCGTCGGCGATCGCTGGATGGGAGACATCAGCCAC
TGTCGGATGGTCATGACCTCGAGGATGAACCGATACCTCGTCCTGCTCAAGTTCCGGGACGGCAGCCGAGCCAAG
CAGTGGAAAGGCGAGTTCGACGGCAGGGTGTTCAACTCTATGGAGGCAAGTCTCATCCAAACGCGCTGCCTCGTT
GTTCCAGGGGCTGACCGACCTCTTTCCAGTCCCAAGTTTGCCACGTCGTCTTCGTCAAGTCCATTACCTTTGAGA
CGCCCGGCAGGTCGCGCCGAAACGACCACCCGGCGGCGGCGGCGGCTGCGTCGTCGTCTTCGTCGTCGGCCGTTT
CCAACAGCCTCAAGCCGTTCCCGCCTCCGCCGCCCAACCTCATCGAACTCCCGACCTGCCCCGTGTGCCTGGAGA
GGATGGACGAGACCAATGGGCTGATGACGATACCCTGTTCCCACGTTTTTCACTGCGCCTGCCTTCAGAACTGGA
AAGGTTCGGGATGCCCGGTCTGCCGATTCACAAACGCCTCGTCGCAGATGGGCGCCGTCGACGCCAACAACCCGT
ACTCGCAGCCGTTCGGGTCGCCCGTGTCCAACATGTGCAGCGTGTGCGACTGCACGGACGACCTCTGGATCTGCC
TCATCTGCGGCTACGTCGGCTGCGGCCGCTACAAGGGCGGCCACGCCAAGGACCACTGGAAGGAGACGGCGCACA
GCTTCGCCCTGGAGCTCGAGACGCAGCACGTCTGGGACTACGCCGGGGACATGTGGGTGCACCGCCTGATCCGCG
ACAAGGGCGACGGCAAGGTCGTCGAGCTGCCCGGCCGGGGCAACCACGGCGGGCAGGGCGACGAGGACGTGGTGC
CGCGGGCCAAGCTGGAGAACATCGGGCTCGAGTACACGCACCTGATTACGAGCCAGCTCGAGTCGCAGCGGGCCT
ACTACGAGGAGATGATCAGCAAGGCGGTCGACAAGGCGGCCAAGGCGACGGCCGTGGCGGAGAGCAGCGCCGCGC
AGTCGGCCGAGACGAGGGAGCGGCTCGCGGCGCTCGAGGACAGGCACAGGACGCTCAGCGCCGACACGCTCCCGC
AGCTCGAGCGCGAGCTGGAGCGGGAGAAGAAGAAGGCGGGCCGGGCGGAGACGCTGGCGCGCGGCCTGGGCCAGG
CGCTGCAGGAGGAGAAGCGGCTGAACGAGGGCCTCATGAAGCGCATCGAGCACCTGGGCGCGGACGGCGCGGCGG
TGCGGGAGGAGCTCTCGGCGCTCAAGGAGGAGAACGCGGAGCTCAAGGAGATGAACCGCGACCTGTCCATGTTCA
TCTCCGGGCAGGAGAAGCTCAAGGAGCTGGAGCGGGAGGGCAAGGTGGAGGAGGGGGAGGTTGCCGAGGGGAGCA
TGAGCGTGCCGGAGAAGAAGGGCCGGAGAAGGGCGCGCAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail