Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2105
Gene name
LocationContig_1490:54..2560
Strand-
Gene length (bp)2506
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 4.8E-05 246 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7P0|YOL4_SCHPO Uncharacterized acyltransferase C1718.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1718.04 PE=1 SV=1 36 624 1.0E-170
sp|P32784|GPT1_YEAST Glycerol-3-phosphate O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCT1 PE=1 SV=3 24 700 3.0E-152
sp|P36148|GPT2_YEAST Glycerol-3-phosphate O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPT2 PE=1 SV=1 4 621 8.0E-135

GO

GO Term Description Terminal node
GO:0016746 transferase activity, transferring acyl groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 453 475 22
2 506 528 22
3 543 565 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2105
MAPADEESREPAASGPASHPGDRSAPKKELYPMVKWKYDLFLYVMGNLVDLFFREVVPRGSWRVPQSGPVLFVAA
PHANQFVDALILQRTLKHEANRRVSLLIAQKSVHGFIGWGSRQVGSVPVGRAQDSAKPATGTIYLPDPINDPTLV
RGVGTRFGQGEGELQGMLFLPSGKNTTGASVDIAKIMGPEEIRVKRPFKGKLAMQQLTGRDDVDADGRLLDTKLR
GPAPGYHGTKFKLAPHIDQTKVYEAVFARLRHGGCVGIFPEGGSHDRTELLPLKAGVAIMALGTLAESPGCGLKI
VPVGMNYFHAHKFRSRAVVEFGTPFEIPPYVVELYRNSQRREAIGQVLDTVYQALSSVTVSAPDYDTLMLVQAAR
RLYNPTGKKLPLPIVVELNRRLAMGYERYKNDERITSLSKSVKDYNSKLRYLNLKDHQVQYARQSITKVLCLFVY
RSIKLALLFLCTVPGLLLFAPVFVATKVISRHKAQTALAGSTVKIRGRDVMATWKILVALGLAPTLYHVYSIVFV
LKVWHDRLWGHAPAWVPLWLAYLAVWPVMIGITLAALRFGEVGMDIFKSLRPLVLCLVPTSSYSIHELKAQRAQL
SAQVTDLINELGPDMFADFDKTRLVPDATRVESAGSQATTPGGGRRDSEQSSGGFETESPPSLSRRSTTQSSRAL
PRNDSFSNIGAVGIFSTRPPSRSRSRSRSSSAGGGLGSGGFPISAFTTLDSAEGFNEATRKIRQAMKDRRKRSDQ
VRMRTGGGGGGGGGGDDGDDDDDDNNNNNNNGEVDSEAEQGYSEARKKNM*
Coding >Hirsu2|2105
ATGGCTCCCGCCGACGAAGAAAGCCGCGAGCCGGCGGCTTCGGGGCCCGCCTCTCACCCCGGCGATCGGTCCGCG
CCGAAAAAGGAGCTGTACCCCATGGTCAAGTGGAAATACGACCTCTTCCTCTACGTCATGGGCAACCTTGTCGAC
CTGTTCTTCCGCGAGGTCGTGCCGAGGGGCTCGTGGAGGGTCCCGCAGTCGGGCCCAGTGCTGTTCGTCGCCGCT
CCGCACGCCAACCAGTTCGTCGACGCCCTCATCCTCCAGCGGACGCTCAAGCACGAGGCCAACCGCCGCGTCTCG
CTCCTCATCGCCCAAAAGTCGGTCCACGGCTTCATCGGCTGGGGCTCCCGGCAGGTCGGCTCCGTCCCCGTCGGC
CGGGCGCAGGACTCGGCCAAGCCGGCGACGGGCACCATCTACCTGCCCGACCCGATCAATGACCCGACCCTGGTC
CGCGGCGTCGGCACCCGCTTCGGCCAGGGCGAGGGCGAGCTGCAGGGCATGCTGTTCCTGCCGTCCGGCAAGAAC
ACGACGGGGGCCAGCGTCGACATCGCCAAGATCATGGGCCCCGAGGAGATACGGGTCAAGCGGCCGTTCAAGGGC
AAGCTGGCCATGCAGCAGCTCACGGGCCGCGACGACGTCGACGCCGACGGCCGGCTGCTCGACACCAAGCTGCGC
GGGCCCGCCCCCGGCTACCACGGCACCAAGTTCAAGCTGGCCCCCCACATCGACCAGACCAAGGTGTACGAGGCC
GTCTTCGCCCGGCTGCGCCACGGCGGCTGCGTCGGCATCTTCCCCGAGGGCGGCAGCCACGACCGGACCGAGCTG
CTGCCGCTCAAGGCCGGCGTCGCCATCATGGCGCTCGGCACGCTGGCCGAGTCGCCCGGCTGCGGGCTCAAGATC
GTGCCGGTCGGCATGAACTACTTCCACGCCCACAAGTTCCGCTCGCGCGCCGTCGTCGAGTTCGGGACCCCCTTC
GAGATCCCGCCCTACGTCGTCGAGCTGTACCGCAACAGCCAGCGGCGCGAGGCCATCGGCCAGGTGCTCGACACC
GTCTACCAGGCCCTGAGCTCCGTCACCGTGTCGGCGCCCGACTACGACACGCTCATGCTGGTGCAGGCGGCCCGG
CGGCTGTACAACCCGACGGGCAAGAAGCTGCCGCTGCCCATCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGC
TACGAGCGCTACAAGAACGACGAGCGCATCACGTCGCTGTCCAAGTCGGTCAAGGACTACAACTCGAAGCTGCGC
TACCTCAACCTCAAGGACCACCAGGTGCAGTACGCGCGCCAGTCCATCACCAAGGTGCTCTGCCTCTTCGTCTAC
CGCTCCATCAAGCTGGCCCTGCTCTTCCTGTGCACGGTGCCGGGCCTGCTCCTGTTCGCGCCCGTCTTCGTGGCG
ACCAAGGTGATCAGCCGGCACAAGGCGCAGACGGCGCTGGCCGGCTCGACGGTCAAGATCCGCGGGCGCGACGTC
ATGGCGACGTGGAAGATCCTGGTGGCGCTCGGGCTGGCGCCGACGCTCTACCACGTCTACTCCATCGTCTTCGTG
CTCAAGGTGTGGCACGACCGGCTCTGGGGCCACGCGCCGGCGTGGGTGCCGCTGTGGCTGGCGTACCTGGCCGTG
TGGCCGGTCATGATCGGCATCACGCTGGCGGCGCTGCGCTTCGGCGAGGTGGGCATGGACATCTTCAAGTCGCTG
CGGCCGCTGGTGCTGTGCCTGGTGCCGACGTCGTCGTACAGCATCCACGAGCTCAAGGCGCAGCGGGCGCAGCTG
AGCGCGCAGGTGACGGACCTGATCAACGAGCTGGGGCCCGACATGTTCGCCGACTTTGACAAGACGCGCCTCGTG
CCGGACGCGACGCGGGTCGAGTCGGCCGGGTCGCAGGCGACGACGCCGGGCGGCGGGCGGCGGGACAGCGAGCAG
TCGAGCGGCGGCTTCGAGACGGAGTCGCCGCCTTCGCTGTCGCGGCGCAGCACGACGCAGTCGAGCCGGGCGCTG
CCGCGCAACGACTCGTTCAGCAACATCGGCGCCGTCGGCATCTTCTCGACGCGCCCGCCGTCGCGGTCCCGGAGC
CGGTCGCGGTCGAGCAGCGCCGGCGGCGGCCTGGGCTCGGGCGGCTTCCCCATCAGCGCCTTCACCACGCTCGAC
TCGGCCGAGGGCTTCAACGAGGCGACCCGCAAGATACGGCAGGCGATGAAGGACCGGCGGAAGCGGTCGGACCAG
GTCAGGATGCGGACGGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGACGGCGACGACGACGACGACGACAAC
AACAACAACAACAACAACGGGGAGGTGGACAGCGAGGCCGAGCAGGGATACAGCGAGGCGAGGAAGAAGAACATG
TAG
Transcript >Hirsu2|2105
ATGGCTCCCGCCGACGAAGAAAGCCGCGAGCCGGCGGCTTCGGGGCCCGCCTCTCACCCCGGCGATCGGTCCGCG
CCGAAAAAGGAGCTGTACCCCATGGTCAAGTGGAAATACGACCTCTTCCTCTACGTCATGGGCAACCTTGTCGAC
CTGTTCTTCCGCGAGGTCGTGCCGAGGGGCTCGTGGAGGGTCCCGCAGTCGGGCCCAGTGCTGTTCGTCGCCGCT
CCGCACGCCAACCAGTTCGTCGACGCCCTCATCCTCCAGCGGACGCTCAAGCACGAGGCCAACCGCCGCGTCTCG
CTCCTCATCGCCCAAAAGTCGGTCCACGGCTTCATCGGCTGGGGCTCCCGGCAGGTCGGCTCCGTCCCCGTCGGC
CGGGCGCAGGACTCGGCCAAGCCGGCGACGGGCACCATCTACCTGCCCGACCCGATCAATGACCCGACCCTGGTC
CGCGGCGTCGGCACCCGCTTCGGCCAGGGCGAGGGCGAGCTGCAGGGCATGCTGTTCCTGCCGTCCGGCAAGAAC
ACGACGGGGGCCAGCGTCGACATCGCCAAGATCATGGGCCCCGAGGAGATACGGGTCAAGCGGCCGTTCAAGGGC
AAGCTGGCCATGCAGCAGCTCACGGGCCGCGACGACGTCGACGCCGACGGCCGGCTGCTCGACACCAAGCTGCGC
GGGCCCGCCCCCGGCTACCACGGCACCAAGTTCAAGCTGGCCCCCCACATCGACCAGACCAAGGTGTACGAGGCC
GTCTTCGCCCGGCTGCGCCACGGCGGCTGCGTCGGCATCTTCCCCGAGGGCGGCAGCCACGACCGGACCGAGCTG
CTGCCGCTCAAGGCCGGCGTCGCCATCATGGCGCTCGGCACGCTGGCCGAGTCGCCCGGCTGCGGGCTCAAGATC
GTGCCGGTCGGCATGAACTACTTCCACGCCCACAAGTTCCGCTCGCGCGCCGTCGTCGAGTTCGGGACCCCCTTC
GAGATCCCGCCCTACGTCGTCGAGCTGTACCGCAACAGCCAGCGGCGCGAGGCCATCGGCCAGGTGCTCGACACC
GTCTACCAGGCCCTGAGCTCCGTCACCGTGTCGGCGCCCGACTACGACACGCTCATGCTGGTGCAGGCGGCCCGG
CGGCTGTACAACCCGACGGGCAAGAAGCTGCCGCTGCCCATCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGC
TACGAGCGCTACAAGAACGACGAGCGCATCACGTCGCTGTCCAAGTCGGTCAAGGACTACAACTCGAAGCTGCGC
TACCTCAACCTCAAGGACCACCAGGTGCAGTACGCGCGCCAGTCCATCACCAAGGTGCTCTGCCTCTTCGTCTAC
CGCTCCATCAAGCTGGCCCTGCTCTTCCTGTGCACGGTGCCGGGCCTGCTCCTGTTCGCGCCCGTCTTCGTGGCG
ACCAAGGTGATCAGCCGGCACAAGGCGCAGACGGCGCTGGCCGGCTCGACGGTCAAGATCCGCGGGCGCGACGTC
ATGGCGACGTGGAAGATCCTGGTGGCGCTCGGGCTGGCGCCGACGCTCTACCACGTCTACTCCATCGTCTTCGTG
CTCAAGGTGTGGCACGACCGGCTCTGGGGCCACGCGCCGGCGTGGGTGCCGCTGTGGCTGGCGTACCTGGCCGTG
TGGCCGGTCATGATCGGCATCACGCTGGCGGCGCTGCGCTTCGGCGAGGTGGGCATGGACATCTTCAAGTCGCTG
CGGCCGCTGGTGCTGTGCCTGGTGCCGACGTCGTCGTACAGCATCCACGAGCTCAAGGCGCAGCGGGCGCAGCTG
AGCGCGCAGGTGACGGACCTGATCAACGAGCTGGGGCCCGACATGTTCGCCGACTTTGACAAGACGCGCCTCGTG
CCGGACGCGACGCGGGTCGAGTCGGCCGGGTCGCAGGCGACGACGCCGGGCGGCGGGCGGCGGGACAGCGAGCAG
TCGAGCGGCGGCTTCGAGACGGAGTCGCCGCCTTCGCTGTCGCGGCGCAGCACGACGCAGTCGAGCCGGGCGCTG
CCGCGCAACGACTCGTTCAGCAACATCGGCGCCGTCGGCATCTTCTCGACGCGCCCGCCGTCGCGGTCCCGGAGC
CGGTCGCGGTCGAGCAGCGCCGGCGGCGGCCTGGGCTCGGGCGGCTTCCCCATCAGCGCCTTCACCACGCTCGAC
TCGGCCGAGGGCTTCAACGAGGCGACCCGCAAGATACGGCAGGCGATGAAGGACCGGCGGAAGCGGTCGGACCAG
GTCAGGATGCGGACGGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGACGACGGCGACGACGACGACGACGACAAC
AACAACAACAACAACAACGGGGAGGTGGACAGCGAGGCCGAGCAGGGATACAGCGAGGCGAGGAAGAAGAACATG
TAG
Gene >Hirsu2|2105
ATGGCTCCCGCCGACGAAGAAAGCCGCGAGCCGGCGGCTTCGGGGCCCGCCTCTCACCCCGGCGATCGGTCCGCG
CCGAAAAAGGAGCTGTACCCCATGGTCAAGTGGAAATACGACCTCTTCCTCTACGTCATGGGCAACCTTGTCGAC
CTGTTCTTCCGCGAGGTCGTGCCGAGGGGCTCGTGGAGGGTCCCGCAGTCGGGCCCAGTGCTGTTCGTCGCCGCT
CCGCACGCCAACCAGGTGAGCTCCGTCCCCAAGCCGACCGCATGCGCCAGGCCAGACCGAGGCCGCGGCCACACG
ACCGAGGGCCCGGACGAGCCGCTGACCGACCGTCCGCCCCCAGTTCGTCGACGCCCTCATCCTCCAGCGGACGCT
CAAGCACGAGGCCAACCGCCGCGTCTCGCTCCTCATCGCCCAAAAGTCGGTCCACGGCTTCATCGGCTGGGGCTC
CCGGCAGGTCGGCTCCGTCCCCGTCGGCCGGGCGCAGGACTCGGCCAAGCCGGCGACGGGCACCATCTACCTGCC
CGACCCGATCAATGACCCGACCCTGGTCCGCGGCGTCGGCACCCGCTTCGGCCAGGGCGAGGGCGAGCTGCAGGG
CATGCTGTTCCTGCCGTCCGGCAAGAACACGACGGGGGCCAGCGTCGACATCGCCAAGATCATGGGCCCCGAGGA
GATACGGGTCAAGCGGCCGTTCAAGGGCAAGCTGGCCATGCAGCAGCTCACGGGCCGCGACGACGTCGACGCCGA
CGGCCGGCTGCTCGACACCAAGCTGCGCGGGCCCGCCCCCGGCTACCACGGCACCAAGTTCAAGCTGGCCCCCCA
CATCGACCAGACCAAGGTGTACGAGGCCGTCTTCGCCCGGCTGCGCCACGGCGGCTGCGTCGGCATCTTCCCCGA
GGGCGGCAGCCACGACCGGACCGAGCTGCTGCCGCTCAAGGCCGGCGTCGCCATCATGGCGCTCGGCACGCTGGC
CGAGTCGCCCGGCTGCGGGCTCAAGATCGTGCCGGTCGGCATGAACTACTTCCACGCCCACAAGTTCCGCTCGCG
CGCCGTCGTCGAGTTCGGGACCCCCTTCGAGATCCCGCCCTACGTCGTCGAGCTGTACCGCAACAGCCAGCGGCG
CGAGGCCATCGGCCAGGTGCTCGACACCGTCTACCAGGCCCTGAGCTCCGTCACCGTGTCGGCGCCCGACTACGA
CACGCTCATGCTGGTGCAGGCGGCCCGGCGGCTGTACAACCCGACGGGCAAGAAGCTGCCGCTGCCCATCGTCGT
CGAGCTCAACCGGCGGCTGGCCATGGGCTACGAGCGCTACAAGAACGACGAGCGCATCACGTCGCTGTCCAAGTC
GGTCAAGGACTACAACTCGAAGCTGCGCTACCTCAACCTCAAGGACCACCAGGTGCAGTACGCGCGCCAGTCCAT
CACCAAGGTGCTCTGCCTCTTCGTCTACCGCTCCATCAAGCTGGCCCTGCTCTTCCTGTGCACGGTGCCGGGCCT
GCTCCTGTTCGCGCCCGTCTTCGTGGCGACCAAGGTGATCAGCCGGCACAAGGCGCAGACGGCGCTGGCCGGCTC
GACGGTCAAGATCCGCGGGCGCGACGTCATGGCGACGTGGAAGATCCTGGTGGCGCTCGGGCTGGCGCCGACGCT
CTACCACGTCTACTCCATCGTCTTCGTGCTCAAGGTGTGGCACGACCGGCTCTGGGGCCACGCGCCGGCGTGGGT
GCCGCTGTGGCTGGCGTACCTGGCCGTGTGGCCGGTCATGATCGGCATCACGCTGGCGGCGCTGCGCTTCGGCGA
GGTGGGCATGGACATCTTCAAGTCGCTGCGGCCGCTGGTGCTGTGCCTGGTGCCGACGTCGTCGTACAGCATCCA
CGAGCTCAAGGCGCAGCGGGCGCAGCTGAGCGCGCAGGTGACGGACCTGATCAACGAGCTGGGGCCCGACATGTT
CGCCGACTTTGACAAGACGCGCCTCGTGCCGGACGCGACGCGGGTCGAGTCGGCCGGGTCGCAGGCGACGACGCC
GGGCGGCGGGCGGCGGGACAGCGAGCAGTCGAGCGGCGGCTTCGAGACGGAGTCGCCGCCTTCGCTGTCGCGGCG
CAGCACGACGCAGTCGAGCCGGGCGCTGCCGCGCAACGACTCGTTCAGCAACATCGGCGCCGTCGGCATCTTCTC
GACGCGCCCGCCGTCGCGGTCCCGGAGCCGGTCGCGGTCGAGCAGCGCCGGCGGCGGCCTGGGCTCGGGCGGCTT
CCCCATCAGCGCCTTCACCACGCTCGACTCGGCCGAGGGCTTCAACGAGGCGACCCGCAAGATACGGCAGGCGAT
GAAGGACCGGCGGAAGCGGTCGGACCAGGTCAGGATGCGGACGGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGA
CGACGGCGACGACGACGACGACGACAACAACAACAACAACAACAACGGGGAGGTGGACAGCGAGGCCGAGCAGGG
ATACAGCGAGGCGAGGAAGAAGAACATGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail