Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2101
Gene name
LocationContig_149:26526..27460
Strand+
Gene length (bp)934
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01479 S4 S4 domain 2.7E-12 121 164
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 5.0E-05 25 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52810|RS9_PODAS 40S ribosomal protein S9 OS=Podospora anserina GN=RPS9 PE=3 SV=1 17 207 1.0E-112
sp|O59675|RS9B_SCHPO 40S ribosomal protein S9-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps902 PE=1 SV=3 17 195 5.0E-103
sp|Q09757|RS9A_SCHPO 40S ribosomal protein S9-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps901 PE=1 SV=2 17 193 1.0E-102
sp|P55935|RS9_DROME 40S ribosomal protein S9 OS=Drosophila melanogaster GN=RpS9 PE=1 SV=2 19 195 4.0E-98
sp|P29314|RS9_RAT 40S ribosomal protein S9 OS=Rattus norvegicus GN=Rps9 PE=1 SV=4 24 207 7.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52810|RS9_PODAS 40S ribosomal protein S9 OS=Podospora anserina GN=RPS9 PE=3 SV=1 17 207 1.0E-112
sp|O59675|RS9B_SCHPO 40S ribosomal protein S9-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps902 PE=1 SV=3 17 195 5.0E-103
sp|Q09757|RS9A_SCHPO 40S ribosomal protein S9-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps901 PE=1 SV=2 17 193 1.0E-102
sp|P55935|RS9_DROME 40S ribosomal protein S9 OS=Drosophila melanogaster GN=RpS9 PE=1 SV=2 19 195 4.0E-98
sp|P29314|RS9_RAT 40S ribosomal protein S9 OS=Rattus norvegicus GN=Rps9 PE=1 SV=4 24 207 7.0E-96
sp|A9L913|RS9_PAPAN 40S ribosomal protein S9 OS=Papio anubis GN=RPS9 PE=3 SV=1 24 207 7.0E-96
sp|Q6ZWN5|RS9_MOUSE 40S ribosomal protein S9 OS=Mus musculus GN=Rps9 PE=1 SV=3 24 207 7.0E-96
sp|P46781|RS9_HUMAN 40S ribosomal protein S9 OS=Homo sapiens GN=RPS9 PE=1 SV=3 24 207 7.0E-96
sp|A6QLG5|RS9_BOVIN 40S ribosomal protein S9 OS=Bos taurus GN=RPS9 PE=2 SV=1 24 207 7.0E-96
sp|O13516|RS9A_YEAST 40S ribosomal protein S9-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS9A PE=1 SV=3 17 198 4.0E-94
sp|P05755|RS9B_YEAST 40S ribosomal protein S9-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS9B PE=1 SV=4 17 191 4.0E-94
sp|Q20228|RS9_CAEEL 40S ribosomal protein S9 OS=Caenorhabditis elegans GN=rps-9 PE=3 SV=1 23 204 2.0E-93
sp|Q9LXG1|RS91_ARATH 40S ribosomal protein S9-1 OS=Arabidopsis thaliana GN=RPS9B PE=1 SV=1 20 198 1.0E-91
sp|Q9FLF0|RS92_ARATH 40S ribosomal protein S9-2 OS=Arabidopsis thaliana GN=RPS9C PE=1 SV=1 20 194 4.0E-88
sp|P14132|RS9_DICDI 40S ribosomal protein S9 OS=Dictyostelium discoideum GN=rps9 PE=1 SV=1 22 203 7.0E-85
sp|P17959|RS9_TRYBB Probable 40S ribosomal protein S9 OS=Trypanosoma brucei brucei PE=3 SV=1 20 205 4.0E-75
sp|Q25555|RS9_NAEFO 40S ribosomal protein S9 OS=Naegleria fowleri GN=RPS9 PE=2 SV=1 20 196 4.0E-72
sp|Q29197|RS9_PIG 40S ribosomal protein S9 (Fragment) OS=Sus scrofa GN=RPS9 PE=2 SV=1 24 145 1.0E-64
sp|O15612|RS9_ENTHI 40S ribosomal protein S9 OS=Entamoeba histolytica GN=2.t00127 PE=2 SV=2 20 199 1.0E-54
sp|A8A8W3|RS4_IGNH4 30S ribosomal protein S4 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps4 PE=3 SV=1 19 178 2.0E-35
sp|A0B9L2|RS4_METTP 30S ribosomal protein S4 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps4 PE=3 SV=1 19 185 4.0E-35
sp|Q8TVC0|RS4_METKA 30S ribosomal protein S4 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps4 PE=3 SV=1 19 199 3.0E-34
sp|A7IAH7|RS4_METB6 30S ribosomal protein S4 OS=Methanoregula boonei (strain 6A8) GN=rps4 PE=3 SV=1 19 178 4.0E-33
sp|A3DMQ4|RS4_STAMF 30S ribosomal protein S4 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps4 PE=3 SV=1 19 178 8.0E-33
sp|O28000|RS4_ARCFU 30S ribosomal protein S4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps4 PE=3 SV=1 19 179 6.0E-32
sp|Q8SRW6|RS9_ENCCU 40S ribosomal protein S9 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS9 PE=1 SV=1 17 196 3.0E-31
sp|A1RWT8|RS4_THEPD 30S ribosomal protein S4 OS=Thermofilum pendens (strain Hrk 5) GN=rps4 PE=3 SV=1 19 200 5.0E-31
sp|Q2FT97|RS4_METHJ 30S ribosomal protein S4 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps4 PE=3 SV=1 19 180 5.0E-31
sp|Q6KZP7|RS4_PICTO 30S ribosomal protein S4 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps4 PE=3 SV=1 24 196 6.0E-31
sp|Q46GC8|RS4_METBF 30S ribosomal protein S4 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps4 PE=3 SV=1 19 180 6.0E-31
sp|Q96YV8|RS4_SULTO 30S ribosomal protein S4 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps4 PE=3 SV=1 29 183 3.0E-30
sp|A2BK77|RS4_HYPBU 30S ribosomal protein S4 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps4 PE=3 SV=1 29 182 6.0E-30
sp|P54020|RS4_METJA 30S ribosomal protein S4 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps4 PE=3 SV=1 18 180 7.0E-30
sp|P39467|RS4_SULAC 30S ribosomal protein S4 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps4 PE=3 SV=3 19 185 1.0E-29
sp|A2SSV9|RS4_METLZ 30S ribosomal protein S4 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps4 PE=3 SV=1 19 179 1.0E-29
sp|Q9YB58|RS4_AERPE 30S ribosomal protein S4 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps4 PE=3 SV=2 19 178 3.0E-29
sp|C3N8R6|RS4_SULIY 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps4 PE=3 SV=1 19 194 8.0E-29
sp|C3NMQ2|RS4_SULIN 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps4 PE=3 SV=1 19 194 8.0E-29
sp|C3MZ03|RS4_SULIM 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps4 PE=3 SV=1 19 194 8.0E-29
sp|C3MJP5|RS4_SULIL 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps4 PE=3 SV=1 19 194 8.0E-29
sp|C4KJ91|RS4_SULIK 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps4 PE=3 SV=1 19 194 8.0E-29
sp|C3N052|RS4_SULIA 30S ribosomal protein S4 OS=Sulfolobus islandicus (strain M.16.27) GN=rps4 PE=3 SV=1 19 194 8.0E-29
sp|Q9HJD7|RS4_THEAC 30S ribosomal protein S4 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps4 PE=3 SV=1 19 207 2.0E-28
sp|B8GEG7|RS4_METPE 30S ribosomal protein S4 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps4 PE=3 SV=1 19 183 3.0E-28
sp|Q8TRR1|RS4_METAC 30S ribosomal protein S4 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps4 PE=3 SV=1 19 178 3.0E-28
sp|P49214|RS9_TOBAC 40S ribosomal protein S9 (Fragment) OS=Nicotiana tabacum GN=RPS9 PE=2 SV=1 133 190 6.0E-28
sp|A4FWL4|RS4_METM5 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps4 PE=3 SV=1 19 180 4.0E-27
sp|A6VGQ7|RS4_METM7 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps4 PE=3 SV=1 19 180 4.0E-27
sp|Q8PV18|RS4_METMA 30S ribosomal protein S4 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps4 PE=3 SV=1 19 180 7.0E-27
sp|A6UW05|RS4_META3 30S ribosomal protein S4 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps4 PE=3 SV=1 19 180 8.0E-27
sp|O26142|RS4_METTH 30S ribosomal protein S4 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps4 PE=3 SV=1 19 178 9.0E-27
sp|Q97B95|RS4_THEVO 30S ribosomal protein S4 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps4 PE=3 SV=1 19 180 1.0E-26
sp|A5UN53|RS4_METS3 30S ribosomal protein S4 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps4 PE=3 SV=1 19 195 2.0E-26
sp|Q0W1V5|RS4_METAR 30S ribosomal protein S4 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4 PE=3 SV=1 19 178 3.0E-26
sp|P61993|RS4_PYRFU 30S ribosomal protein S4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps4 PE=1 SV=1 19 197 4.0E-26
sp|P61992|RS4_PYRAB 30S ribosomal protein S4 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps4 PE=3 SV=1 19 197 4.0E-26
sp|O59306|RS4_PYRHO 30S ribosomal protein S4 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps4 PE=3 SV=1 19 197 5.0E-26
sp|P95987|RS4_SULSO 30S ribosomal protein S4 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps4 PE=3 SV=1 19 183 1.0E-25
sp|A9A9Z3|RS4_METM6 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps4 PE=3 SV=1 19 180 2.0E-25
sp|C5A251|RS4_THEGJ 30S ribosomal protein S4 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps4 PE=3 SV=1 19 197 3.0E-25
sp|A6UPW5|RS4_METVS 30S ribosomal protein S4 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps4 PE=3 SV=1 19 179 3.0E-25
sp|Q12ZR5|RS4_METBU 30S ribosomal protein S4 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps4 PE=3 SV=1 19 178 4.0E-25
sp|Q3IQT8|RS4_NATPD 30S ribosomal protein S4 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps4 PE=3 SV=1 23 178 4.0E-25
sp|Q6LXN0|RS4_METMP 30S ribosomal protein S4 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps4 PE=3 SV=1 19 180 8.0E-25
sp|C6A1B1|RS4_THESM 30S ribosomal protein S4 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps4 PE=3 SV=1 19 186 9.0E-25
sp|Q5JJF2|RS4_THEKO 30S ribosomal protein S4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps4 PE=3 SV=1 19 197 2.0E-24
sp|A8MDS5|RS4_CALMQ 30S ribosomal protein S4 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps4 PE=3 SV=1 16 176 3.0E-24
sp|Q9HQJ6|RS4_HALSA 30S ribosomal protein S4 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps4 PE=3 SV=1 19 172 3.0E-24
sp|B0R4Y0|RS4_HALS3 30S ribosomal protein S4 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps4 PE=3 SV=1 19 172 3.0E-24
sp|B6YSQ1|RS4_THEON 30S ribosomal protein S4 OS=Thermococcus onnurineus (strain NA1) GN=rps4 PE=3 SV=1 19 197 4.0E-24
sp|Q74NF7|RS4_NANEQ 30S ribosomal protein S4 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps4 PE=3 SV=1 29 198 1.0E-23
sp|A9A436|RS4_NITMS 30S ribosomal protein S4 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps4 PE=3 SV=1 19 204 2.0E-22
sp|Q8ZTV1|RS4_PYRAE 30S ribosomal protein S4 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps4 PE=3 SV=1 45 162 2.0E-22
sp|Q2NFZ4|RS4_METST 30S ribosomal protein S4 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps4 PE=3 SV=1 19 172 2.0E-22
sp|Q18G54|RS4_HALWD 30S ribosomal protein S4 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps4 PE=3 SV=1 17 186 4.0E-22
sp|B1L795|RS4_KORCO 30S ribosomal protein S4 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps4 PE=3 SV=1 20 171 5.0E-22
sp|B1Y9B8|RS4_PYRNV 30S ribosomal protein S4 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps4 PE=3 SV=1 45 162 7.0E-22
sp|Q00862|RS4_HALMA 30S ribosomal protein S4 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps4 PE=3 SV=1 23 178 7.0E-22
sp|A4WM27|RS4_PYRAR 30S ribosomal protein S4 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps4 PE=3 SV=1 45 162 3.0E-21
sp|A1RT03|RS4_PYRIL 30S ribosomal protein S4 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps4 PE=3 SV=1 45 172 3.0E-21
sp|A0RY02|RS4_CENSY 30S ribosomal protein S4 OS=Cenarchaeum symbiosum (strain A) GN=rps4 PE=3 SV=1 16 180 3.0E-21
sp|A3CWH7|RS4_METMJ 30S ribosomal protein S4 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps4 PE=3 SV=1 19 178 7.0E-21
sp|A3MUS9|RS4_PYRCJ 30S ribosomal protein S4 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps4 PE=3 SV=1 45 162 1.0E-20
sp|A4YIN4|RS4_METS5 30S ribosomal protein S4 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps4 PE=3 SV=1 19 183 6.0E-19
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 41 162 2.0E-10
sp|Q3T0M3|IMP3_BOVIN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Bos taurus GN=IMP3 PE=2 SV=1 41 162 1.0E-09
sp|B9MKF4|RS4_CALBD 30S ribosomal protein S4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsD PE=3 SV=1 20 171 7.0E-09
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 41 176 9.0E-09
sp|A4XLQ3|RS4_CALS8 30S ribosomal protein S4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsD PE=3 SV=1 20 162 2.0E-08
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 48 162 3.0E-08
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 41 162 5.0E-08
sp|C0ZHK9|RS4_BREBN 30S ribosomal protein S4 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsD PE=3 SV=1 46 163 8.0E-08
sp|P36447|RR4_ANTOD 30S ribosomal protein S4, chloroplastic (Fragment) OS=Anthoxanthum odoratum GN=rps4 PE=3 SV=1 118 186 4.0E-07
sp|Q74K05|RS4_LACJO 30S ribosomal protein S4 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsD PE=3 SV=1 46 164 4.0E-07
sp|Q042M7|RS4_LACGA 30S ribosomal protein S4 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsD PE=3 SV=2 46 164 4.0E-07
sp|Q2RFS5|RS4_MOOTA 30S ribosomal protein S4 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsD PE=3 SV=1 20 163 8.0E-07
sp|Q03EN4|RS4_PEDPA 30S ribosomal protein S4 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsD PE=3 SV=1 46 164 1.0E-06
sp|A0T0H2|RR4_PHATC 30S ribosomal protein S4, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps4 PE=3 SV=1 110 165 1.0E-06
sp|Q2LQD0|RS4_SYNAS 30S ribosomal protein S4 OS=Syntrophus aciditrophicus (strain SB) GN=rpsD PE=3 SV=1 118 164 1.0E-06
sp|P36472|RR4_STICA 30S ribosomal protein S4, chloroplastic (Fragment) OS=Stipa capensis GN=rps4 PE=3 SV=1 117 186 2.0E-06
sp|Q8A4A1|RS4_BACTN 30S ribosomal protein S4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsD PE=3 SV=1 46 163 2.0E-06
sp|P69636|RR4_BRASY 30S ribosomal protein S4, chloroplastic (Fragment) OS=Brachypodium sylvaticum GN=rps4 PE=3 SV=1 117 186 4.0E-06
sp|P69635|RR4_BRAPI 30S ribosomal protein S4, chloroplastic (Fragment) OS=Brachypodium pinnatum GN=rps4 PE=3 SV=1 117 186 4.0E-06
sp|P36466|RR4_MELUN 30S ribosomal protein S4, chloroplastic (Fragment) OS=Melica uniflora GN=rps4 PE=3 SV=1 117 186 4.0E-06
sp|P36465|RR4_MELAL 30S ribosomal protein S4, chloroplastic (Fragment) OS=Melica altissima GN=rps4 PE=3 SV=1 117 186 4.0E-06
sp|P36464|RR4_LYGSP 30S ribosomal protein S4, chloroplastic (Fragment) OS=Lygeum spartum GN=rps4 PE=3 SV=1 117 186 4.0E-06
sp|Q64NN4|RS4_BACFR 30S ribosomal protein S4 OS=Bacteroides fragilis (strain YCH46) GN=rpsD PE=3 SV=1 46 163 4.0E-06
sp|Q5L8D5|RS4_BACFN 30S ribosomal protein S4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsD PE=3 SV=1 46 163 4.0E-06
sp|A3DJK0|RS4_CLOTH 30S ribosomal protein S4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsD PE=3 SV=1 46 183 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0005622 intracellular Yes
GO:0019843 rRNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0044464 cell part No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2101
MQWRASSVSGFRACSKMPPRAYSKTSRVPRRPFEAARLDSELKLVGEYGLRNKREVWRVGLTLSKIRRAARQLLT
LDEKDPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRV
GKQIVNVPSFIVRLDSQKHIDFALNSPFGSGRPGRVRRKKAKAAEGGAEGEEEEDDE*
Coding >Hirsu2|2101
ATGCAGTGGCGCGCCTCTTCTGTGTCTGGCTTTAGGGCTTGCTCCAAGATGCCTCCTCGCGCGTATTCAAAGACC
TCTCGTGTCCCCCGCAGACCCTTTGAGGCTGCTCGATTGGACTCGGAGTTGAAGCTTGTCGGAGAGTATGGCCTG
CGCAACAAGCGTGAGGTGTGGCGCGTCGGCCTGACACTGTCCAAGATCCGTCGAGCTGCCCGTCAGCTTCTGACC
CTCGACGAGAAGGACCCCAAGCGTCTCTTCGAAGGCAATGCCCTCATTCGCCGTCTCGTCCGCGTCGGTGTGCTC
GACGAGTCTCGCATGAAGCTCGATTACGTGCTGGCCCTGAAGATCGAGGATTTCTTGGAGCGTCGTCTGCAGACC
TGCGTTTACAAGCTCGGTCTCGCCAAATCCATCCACCACGCCCGCGTCCTGATCCGCCAGCGCCACATCCGCGTC
GGCAAGCAGATCGTCAACGTCCCCTCCTTCATCGTCCGTCTCGACTCCCAGAAGCACATCGACTTCGCCCTGAAC
TCGCCCTTCGGCAGCGGCCGTCCCGGCCGTGTCCGCAGAAAGAAGGCCAAGGCCGCCGAGGGTGGCGCCGAGGGT
GAGGAGGAGGAAGACGACGAATGA
Transcript >Hirsu2|2101
ATGCAGTGGCGCGCCTCTTCTGTGTCTGGCTTTAGGGCTTGCTCCAAGATGCCTCCTCGCGCGTATTCAAAGACC
TCTCGTGTCCCCCGCAGACCCTTTGAGGCTGCTCGATTGGACTCGGAGTTGAAGCTTGTCGGAGAGTATGGCCTG
CGCAACAAGCGTGAGGTGTGGCGCGTCGGCCTGACACTGTCCAAGATCCGTCGAGCTGCCCGTCAGCTTCTGACC
CTCGACGAGAAGGACCCCAAGCGTCTCTTCGAAGGCAATGCCCTCATTCGCCGTCTCGTCCGCGTCGGTGTGCTC
GACGAGTCTCGCATGAAGCTCGATTACGTGCTGGCCCTGAAGATCGAGGATTTCTTGGAGCGTCGTCTGCAGACC
TGCGTTTACAAGCTCGGTCTCGCCAAATCCATCCACCACGCCCGCGTCCTGATCCGCCAGCGCCACATCCGCGTC
GGCAAGCAGATCGTCAACGTCCCCTCCTTCATCGTCCGTCTCGACTCCCAGAAGCACATCGACTTCGCCCTGAAC
TCGCCCTTCGGCAGCGGCCGTCCCGGCCGTGTCCGCAGAAAGAAGGCCAAGGCCGCCGAGGGTGGCGCCGAGGGT
GAGGAGGAGGAAGACGACGAATGA
Gene >Hirsu2|2101
ATGCAGTGGCGCGCCTCTTCTGTGTCTGGCTTTAGGGCTTGCTGTTCGGGCTGCACGTGACTTCGGTCCGCGAAA
TTTCCCACCCCACAAGTAGCAGCCTCGAACATTTTCAACATTACGTGCAACTCGTCATCTCCAGCTAACACCACA
GGAGCAAGCCAAGTGAGTTCAAATCGCCGGTCGCCGGCTGCGACGATTAGTTGACAAGGGCCCAGGATGCCTCCT
CGCGCGTATTCAAAGACCTCTCGTGTCCCCCGCAGACCCTTTGAGGCTGCTCGATTGTCAGTATCACCGGCCACT
GAACATGAGCTTGACTCTGTTTAAGTCGAATGTGATGGCGGACTGACCCAGGAAATAATAGGGACTCGGAGTTGA
AGCTTGTCGGAGAGTATGGCCTGCGCAACAAGCGTGAGGTGTGGCGCGTCGGCCTGACACTGTCCAAGATCCGTC
GAGCTGCCCGGTAAGAGGGACCTTGCGAGCGGGAAAGACGGTGCAGGGCGACGAGTGCTAACTCGATCGCAGTCA
GCTTCTGACCCTCGACGAGAAGGACCCCAAGCGTCTCTTCGAAGGCAATGCCCTCATTCGCCGTCTCGTCCGCGT
CGGTGTGCTCGACGAGTCTCGCATGAAGCTCGATTACGTGCTGGCCCTGAAGATCGAGGATTTCTTGGAGCGTCG
TCTGCAGACCTGCGTTTACAAGCTCGGTCTCGCCAAATCCATCCACCACGCCCGCGTCCTGATCCGCCAGCGCCA
CATCCGCGTCGGCAAGCAGATCGTCAACGTCCCCTCCTTCATCGTCCGTCTCGACTCCCAGAAGCACATCGACTT
CGCCCTGAACTCGCCCTTCGGCAGCGGCCGTCCCGGCCGTGTCCGCAGAAAGAAGGCCAAGGCCGCCGAGGGTGG
CGCCGAGGGTGAGGAGGAGGAAGACGACGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail