Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2096
Gene name
LocationContig_149:10434..11657
Strand+
Gene length (bp)1223
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04769 MATalpha_HMGbox Mating-type protein MAT alpha 1 HMG-box 6.9E-53 46 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59851|MAT1_FUSOX Mating-type protein MAT-1 OS=Fusarium oxysporum GN=MAT1 PE=3 SV=2 54 351 5.0E-54
sp|Q9Y8C7|MAT1_COCEL Mating-type protein MAT-1 OS=Cochliobolus ellisii GN=MAT1 PE=3 SV=1 3 184 3.0E-20
sp|Q9Y8D1|MAT1_COCCY Mating-type protein MAT-1 OS=Cochliobolus cymbopogonis GN=MAT1 PE=3 SV=1 57 204 9.0E-20
sp|Q9Y8D3|MAT1_COCKU Mating-type protein MAT-1 OS=Cochliobolus kusanoi GN=MAT1 PE=3 SV=1 59 164 1.0E-19
sp|O94160|MAT1_ALTAL Mating-type protein MAT-1 OS=Alternaria alternata GN=MAT1 PE=3 SV=1 65 203 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59851|MAT1_FUSOX Mating-type protein MAT-1 OS=Fusarium oxysporum GN=MAT1 PE=3 SV=2 54 351 5.0E-54
sp|Q9Y8C7|MAT1_COCEL Mating-type protein MAT-1 OS=Cochliobolus ellisii GN=MAT1 PE=3 SV=1 3 184 3.0E-20
sp|Q9Y8D1|MAT1_COCCY Mating-type protein MAT-1 OS=Cochliobolus cymbopogonis GN=MAT1 PE=3 SV=1 57 204 9.0E-20
sp|Q9Y8D3|MAT1_COCKU Mating-type protein MAT-1 OS=Cochliobolus kusanoi GN=MAT1 PE=3 SV=1 59 164 1.0E-19
sp|O94160|MAT1_ALTAL Mating-type protein MAT-1 OS=Alternaria alternata GN=MAT1 PE=3 SV=1 65 203 2.0E-19
sp|O13402|MAT1_COCCA Mating-type protein MAT-1 OS=Cochliobolus carbonum GN=MAT1 PE=3 SV=1 24 172 2.0E-19
sp|Q02990|MAT1_COCHE Mating-type protein MAT-1 OS=Cochliobolus heterostrophus GN=MAT1 PE=3 SV=1 59 172 4.0E-19
sp|Q9P446|MAT1_COCSA Mating-type protein MAT-1 OS=Cochliobolus sativus GN=MAT1 PE=3 SV=1 59 164 2.0E-18
sp|P35692|FMR1_PODAS Mat- sexual cell fertilization-promoting factor OS=Podospora anserina GN=FMR1 PE=3 SV=1 67 168 8.0E-18
sp|O42837|MTA1_SORMK Mating type protein SmtA-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMTA1 PE=3 SV=2 44 172 1.0E-17
sp|O13596|MTA1_SORFI Mating type protein mtA-1 OS=Sordaria fimicola GN=MTA1 PE=3 SV=1 44 172 2.0E-17
sp|P19392|MATA_NEUCR Mating-type protein A-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtA-1 PE=1 SV=2 67 202 2.0E-17
sp|Q02292|MATA_NEUAF Mating type protein A-1 OS=Neurospora africana GN=MTA-1 PE=3 SV=1 67 172 2.0E-16
sp|O13595|MTA1_SOREQ Mating type protein mtA-1 OS=Sordaria equina GN=MTA1 PE=3 SV=1 34 172 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0008301 DNA binding, bending Yes
GO:0007531 mating type determination Yes
GO:0045895 positive regulation of mating-type specific transcription, DNA-templated Yes
GO:1902680 positive regulation of RNA biosynthetic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0045893 positive regulation of transcription, DNA-templated No
GO:0032502 developmental process No
GO:0051252 regulation of RNA metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0043229 intracellular organelle No
GO:0031323 regulation of cellular metabolic process No
GO:0022414 reproductive process No
GO:0003676 nucleic acid binding No
GO:0050794 regulation of cellular process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0048518 positive regulation of biological process No
GO:0048522 positive regulation of cellular process No
GO:0003006 developmental process involved in reproduction No
GO:1903508 positive regulation of nucleic acid-templated transcription No
GO:0051254 positive regulation of RNA metabolic process No
GO:0005488 binding No
GO:0043226 organelle No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0010557 positive regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0003677 DNA binding No
GO:0009893 positive regulation of metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0050789 regulation of biological process No
GO:0007532 regulation of mating-type specific transcription, DNA-templated No
GO:0051173 positive regulation of nitrogen compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0080090 regulation of primary metabolic process No
GO:0005575 cellular_component No
GO:0045935 positive regulation of nucleobase-containing compound metabolic process No
GO:0009891 positive regulation of biosynthetic process No
GO:0003674 molecular_function No
GO:0031328 positive regulation of cellular biosynthetic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0110165 cellular anatomical entity No
GO:0045165 cell fate commitment No
GO:0007530 sex determination No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0031325 positive regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0048869 cellular developmental process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010604 positive regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.372 0.7006 0.0814 0.0128 0.1447 0.0084 0.0795 0.074 0.1283 0.0225

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2433
Ophiocordyceps camponoti-floridani Ophcf2|06135
Ophiocordyceps kimflemingae Ophio5|3760
Ophiocordyceps subramaniannii Hirsu2|2096 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2096
MTTRAEILQRLSLVRADVLLDLLTDEAIFQLASRYFESTSEADVLAPMDPAASLAPEQAKDASGDKAKRPLNAFM
AFRSYYLKIFPDVQQKTASGFLTTLWHKDPCRNKWALIAKVYSFVRDHLGKEKIALSFFLGIACPTMKVIEPAKY
LESLGWAVRDDDTGSQKLFQDASIDSLAQPASISAEIPSTELELLSSLIEVGYFPNQGVELMDKMNSNHSGIMTT
RDAKYTPPTSHTDEKIDFINTIKNDPVRATREIIGDCCGEDIIQLFGVKSHNVENVDSISHLSMQREYQDPRTFY
NYSTTFERMDFGGPDEPIMGFNNLPEHETFDIDSPFDLDEILGHSHSEGERTANLPPSPEYNPLNNFHFAF*
Coding >Hirsu2|2096
ATGACGACACGAGCAGAGATTCTGCAGCGTCTTTCGCTTGTTCGCGCCGACGTTCTTCTGGACCTTTTGACAGAT
GAGGCTATCTTTCAGCTCGCGTCTCGATATTTCGAGTCAACTTCGGAGGCCGACGTACTTGCGCCCATGGATCCC
GCAGCGTCTCTCGCTCCTGAGCAGGCCAAAGACGCATCCGGTGATAAAGCAAAGCGTCCTCTCAACGCATTTATG
GCATTCAGAAGTTATTATTTGAAGATCTTCCCCGACGTCCAGCAGAAGACAGCATCCGGATTCCTCACCACTCTC
TGGCACAAAGACCCATGCCGGAATAAATGGGCTTTGATCGCGAAAGTCTACTCTTTTGTGAGAGATCATCTTGGA
AAGGAAAAAATCGCTCTCTCGTTTTTTTTGGGCATCGCTTGCCCGACCATGAAAGTCATTGAGCCTGCCAAATAC
CTCGAATCGCTTGGGTGGGCTGTCCGAGACGACGACACAGGATCCCAGAAGCTTTTCCAAGATGCCTCCATCGAT
TCCCTGGCCCAGCCGGCATCAATTTCAGCAGAAATCCCCAGCACAGAACTTGAACTCTTATCCTCGCTCATTGAA
GTTGGATATTTCCCCAATCAAGGCGTCGAACTCATGGACAAGATGAACTCCAACCACAGCGGCATCATGACCACG
CGCGATGCAAAATATACTCCTCCTACTTCACATACAGATGAAAAGATCGACTTCATCAACACCATCAAGAATGAT
CCTGTGCGTGCGACTAGGGAAATCATTGGCGATTGCTGCGGCGAAGATATTATCCAGCTTTTCGGAGTAAAGAGC
CACAATGTCGAAAACGTGGACTCAATCTCCCACCTCTCGATGCAACGCGAATACCAAGACCCTCGAACCTTTTAC
AATTACTCCACCACCTTCGAAAGGATGGATTTCGGTGGCCCTGATGAGCCCATCATGGGCTTCAATAATTTGCCT
GAGCATGAGACTTTCGACATCGATAGTCCTTTTGATCTTGACGAGATTCTCGGTCATTCCCATTCGGAGGGTGAA
AGAACTGCAAATCTTCCTCCGAGCCCTGAATACAACCCGCTAAATAACTTCCACTTTGCGTTCTAA
Transcript >Hirsu2|2096
ATGACGACACGAGCAGAGATTCTGCAGCGTCTTTCGCTTGTTCGCGCCGACGTTCTTCTGGACCTTTTGACAGAT
GAGGCTATCTTTCAGCTCGCGTCTCGATATTTCGAGTCAACTTCGGAGGCCGACGTACTTGCGCCCATGGATCCC
GCAGCGTCTCTCGCTCCTGAGCAGGCCAAAGACGCATCCGGTGATAAAGCAAAGCGTCCTCTCAACGCATTTATG
GCATTCAGAAGTTATTATTTGAAGATCTTCCCCGACGTCCAGCAGAAGACAGCATCCGGATTCCTCACCACTCTC
TGGCACAAAGACCCATGCCGGAATAAATGGGCTTTGATCGCGAAAGTCTACTCTTTTGTGAGAGATCATCTTGGA
AAGGAAAAAATCGCTCTCTCGTTTTTTTTGGGCATCGCTTGCCCGACCATGAAAGTCATTGAGCCTGCCAAATAC
CTCGAATCGCTTGGGTGGGCTGTCCGAGACGACGACACAGGATCCCAGAAGCTTTTCCAAGATGCCTCCATCGAT
TCCCTGGCCCAGCCGGCATCAATTTCAGCAGAAATCCCCAGCACAGAACTTGAACTCTTATCCTCGCTCATTGAA
GTTGGATATTTCCCCAATCAAGGCGTCGAACTCATGGACAAGATGAACTCCAACCACAGCGGCATCATGACCACG
CGCGATGCAAAATATACTCCTCCTACTTCACATACAGATGAAAAGATCGACTTCATCAACACCATCAAGAATGAT
CCTGTGCGTGCGACTAGGGAAATCATTGGCGATTGCTGCGGCGAAGATATTATCCAGCTTTTCGGAGTAAAGAGC
CACAATGTCGAAAACGTGGACTCAATCTCCCACCTCTCGATGCAACGCGAATACCAAGACCCTCGAACCTTTTAC
AATTACTCCACCACCTTCGAAAGGATGGATTTCGGTGGCCCTGATGAGCCCATCATGGGCTTCAATAATTTGCCT
GAGCATGAGACTTTCGACATCGATAGTCCTTTTGATCTTGACGAGATTCTCGGTCATTCCCATTCGGAGGGTGAA
AGAACTGCAAATCTTCCTCCGAGCCCTGAATACAACCCGCTAAATAACTTCCACTTTGCGTTCTAA
Gene >Hirsu2|2096
ATGACGACACGAGCAGAGATTCTGCAGCGTCTTTCGCTTGTTCGCGCCGACGTTCTTCTGGACCTTTTGACAGAT
GAGGCTATCTTTCAGCTCGCGTCTCGATATTTCGAGTCAACTTCGGAGGCCGACGTACTTGCGCCCATGGATCCC
GCAGCGTCTCTCGCTCCTGAGCAGGCCAAAGACGCATCCGGTGATAAAGCAAAGCGTCCTCTCAACGCATTTATG
GCATTCAGAAGTAAGCTAGCTTGTCTCTGGGTTCAAGAAGATTGCTGACGGAGAGATTAAAGGTTATTATTTGAA
GATCTTCCCCGACGTCCAGCAGAAGACAGCATCCGGATTCCTCACCACTCTCTGGCACAAAGACCCATGCCGGAA
TAAATGGGCTTTGATCGCGAAAGTCTACTCTTTTGTGAGAGATCATCTTGGAAAGGAAAAAATCGCTCTCTCGTT
TTTTTTGGGCATCGCTTGCCCGACCATGAAAGTCATTGAGCCTGCCAAATACCTCGAATCGCTTGGGTGGGCTGT
CCGAGACGACGACACAGGATCCCAGAAGCTTTTCCAAGATGCCTCCATCGATTCCCTGGCCCAGCCGGCATCAAT
TTCAGCAGAAATCCCCAGCACAGAACTTGAACTCTTATCCTCGCTCATTGAAGTTGGATATTTCCCCAATCAAGG
CGTCGAACTCATGGACAAGATGAACTCCAACCACAGCGGCATCATGACCACGCGCGATGCAAAATATACTCCTCC
TACTTCACATACAGATGAAAAGATCGACTTCATCAACACCATCAAGAATGATCCTGTGCGTGCGACTAGGGAAAT
CATTGGCGATTGCTGCGGCGAAGATATTATCCAGCTTTTCGGAGTAAAGAGCCACAATGTCGAAAACGTGGACTC
AATCTCCCACCTCTCGATGCAACGCGAATACCAAGACCCTCGAACCTTTTACAATTACTCCACCACCTTCGAAAG
GATGGATTTCGGTGGCCCTGATGAGCCCATCATGGGCTTCAATAATTTGCCTGAGCATGAGACTTTCGACATCGA
TAGTCCTTTTGATCTTGACGAGATTCTCGGTCATTCCCATTCGGAGGGTGAAAGAAGTAAGTGGCTCTTCTCCTG
GCTCCTTGTAAAAAGTTCTTAACTGACCAGATCTAGCTGCAAATCTTCCTCCGAGCCCTGAATACAACCCGCTAA
ATAACTTCCACTTTGCGTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail