Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2091
Gene name
LocationContig_149:2723..3465
Strand-
Gene length (bp)742
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02046 COX6A Cytochrome c oxidase subunit VIa 1.9E-53 20 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74471|COX13_SCHPO Cytochrome c oxidase subunit 6A, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox13 PE=3 SV=1 25 126 8.0E-22
sp|P32799|COX13_YEAST Cytochrome c oxidase subunit 6A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX13 PE=1 SV=1 34 123 5.0E-18
sp|Q20779|COX6A_CAEEL Probable cytochrome c oxidase subunit 6A, mitochondrial OS=Caenorhabditis elegans GN=tag-174 PE=3 SV=1 46 122 8.0E-12
sp|P12074|CX6A1_HUMAN Cytochrome c oxidase subunit 6A1, mitochondrial OS=Homo sapiens GN=COX6A1 PE=1 SV=4 48 121 2.0E-10
sp|P43024|CX6A1_MOUSE Cytochrome c oxidase subunit 6A1, mitochondrial OS=Mus musculus GN=Cox6a1 PE=1 SV=2 6 121 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74471|COX13_SCHPO Cytochrome c oxidase subunit 6A, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox13 PE=3 SV=1 25 126 8.0E-22
sp|P32799|COX13_YEAST Cytochrome c oxidase subunit 6A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX13 PE=1 SV=1 34 123 5.0E-18
sp|Q20779|COX6A_CAEEL Probable cytochrome c oxidase subunit 6A, mitochondrial OS=Caenorhabditis elegans GN=tag-174 PE=3 SV=1 46 122 8.0E-12
sp|P12074|CX6A1_HUMAN Cytochrome c oxidase subunit 6A1, mitochondrial OS=Homo sapiens GN=COX6A1 PE=1 SV=4 48 121 2.0E-10
sp|P43024|CX6A1_MOUSE Cytochrome c oxidase subunit 6A1, mitochondrial OS=Mus musculus GN=Cox6a1 PE=1 SV=2 6 121 3.0E-10
sp|O13082|COX6A_CYPCA Cytochrome c oxidase subunit 6A, mitochondrial OS=Cyprinus carpio PE=3 SV=1 22 121 4.0E-10
sp|O13085|COX6A_ONCMY Cytochrome c oxidase subunit 6A, mitochondrial OS=Oncorhynchus mykiss PE=3 SV=1 45 121 2.0E-09
sp|Q9TTT7|CX6A1_RABIT Cytochrome c oxidase subunit 6A1, mitochondrial OS=Oryctolagus cuniculus GN=COX6A1 PE=3 SV=1 48 121 6.0E-09
sp|P10818|CX6A1_RAT Cytochrome c oxidase subunit 6A1, mitochondrial OS=Rattus norvegicus GN=Cox6a1 PE=1 SV=2 48 121 7.0E-09
sp|P13182|CX6A1_BOVIN Cytochrome c oxidase subunit 6A1, mitochondrial OS=Bos taurus GN=COX6A1 PE=1 SV=3 48 121 4.0E-08
sp|Q02221|CX6A2_HUMAN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Homo sapiens GN=COX6A2 PE=2 SV=2 53 121 4.0E-07
sp|Q5RC38|CX6A2_PONAB Cytochrome c oxidase subunit 6A2, mitochondrial OS=Pongo abelii GN=COX6A2 PE=3 SV=1 53 121 5.0E-07
sp|P10817|CX6A2_RAT Cytochrome c oxidase subunit 6A2, mitochondrial (Fragment) OS=Rattus norvegicus GN=Cox6a2 PE=1 SV=3 44 121 8.0E-07
sp|P43023|CX6A2_MOUSE Cytochrome c oxidase subunit 6A2, mitochondrial OS=Mus musculus GN=Cox6a2 PE=1 SV=2 44 121 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005751 mitochondrial respiratory chain complex IV Yes
GO:0004129 cytochrome-c oxidase activity Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0008324 cation transmembrane transporter activity No
GO:0044446 intracellular organelle part No
GO:0016675 oxidoreductase activity, acting on a heme group of donors No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0019866 organelle inner membrane No
GO:0003824 catalytic activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0015078 proton transmembrane transporter activity No
GO:0016020 membrane No
GO:0044425 membrane part No
GO:0044455 mitochondrial membrane part No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0016491 oxidoreductase activity No
GO:0015002 heme-copper terminal oxidase activity No
GO:0070069 cytochrome complex No
GO:0098803 respiratory chain complex No
GO:0031966 mitochondrial membrane No
GO:0098798 mitochondrial protein complex No
GO:0022857 transmembrane transporter activity No
GO:0031090 organelle membrane No
GO:0005215 transporter activity No
GO:0045277 respiratory chain complex IV No
GO:0044429 mitochondrial part No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0016676 oxidoreductase activity, acting on a heme group of donors, oxygen as acceptor No
GO:0005575 cellular_component No
GO:0009055 electron transfer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2091
MFASRQAVRGASRFAAQLRAPAQRRLASSSTENQFIKERQHIKEHAAGTTELWRKISIYGVIPCLALAGANAYYL
WNAHWEHWSHMPPLEERVEYPYQNIRTKNFPWGDGDKTLFWNDSVNYHNKDKTS*
Coding >Hirsu2|2091
ATGTTCGCCTCACGACAAGCCGTCCGTGGCGCCTCGCGCTTCGCCGCGCAGCTTCGCGCACCCGCCCAGCGACGT
CTGGCCAGCTCGTCGACCGAGAACCAGTTCATCAAGGAGCGCCAGCACATCAAGGAGCACGCTGCGGGGACAACT
GAGCTGTGGAGGAAGATCTCCATCTACGGTGTGATTCCCTGCCTCGCCCTCGCCGGTGCCAACGCCTACTACCTG
TGGAACGCCCACTGGGAGCACTGGTCGCATATGCCCCCGCTGGAGGAGCGCGTTGAGTACCCATACCAGAACATT
CGCACCAAGAACTTTCCGTGGGGCGATGGCGACAAGACGCTCTTCTGGAACGACAGTGTCAACTACCACAACAAG
GACAAGACTTCGTAA
Transcript >Hirsu2|2091
ATGTTCGCCTCACGACAAGCCGTCCGTGGCGCCTCGCGCTTCGCCGCGCAGCTTCGCGCACCCGCCCAGCGACGT
CTGGCCAGCTCGTCGACCGAGAACCAGTTCATCAAGGAGCGCCAGCACATCAAGGAGCACGCTGCGGGGACAACT
GAGCTGTGGAGGAAGATCTCCATCTACGGTGTGATTCCCTGCCTCGCCCTCGCCGGTGCCAACGCCTACTACCTG
TGGAACGCCCACTGGGAGCACTGGTCGCATATGCCCCCGCTGGAGGAGCGCGTTGAGTACCCATACCAGAACATT
CGCACCAAGAACTTTCCGTGGGGCGATGGCGACAAGACGCTCTTCTGGAACGACAGTGTCAACTACCACAACAAG
GACAAGACTTCGTAA
Gene >Hirsu2|2091
ATGTTCGCCTCACGACAAGCCGTCCGTGGCGCCTCGCGCTTCGCCGCGCAGCTTCGCGCACCCGCCCAGCGACGT
CTGGCCAGCTCGTCGACCGAGAACCAGTTCATCAAGGAGCGCCAGCACATCAAGGAGCACGCTGCGGGGACAACT
GGTGAGTCAGCGGCGCCTGGCAGCTTGCTTGGGTGGTCGGACGAGAGACGTATACTGACGATTGACTTTGCAGAG
CTGTGGAGGAAGATCTCCATCTAGTACGTCACACGCTCCCGCCTTCGCGATCGCTCCCCTCCGTCGAGAGCATCC
CATTCCGACTGCTAGGGCATCGCGCCAGGCGATCCGCTTCAGTGGCAGGAGGGAGGCTGACAGGCGTCGAAGCGG
TGTGATTCCCTGCCTCGCCCTCGCCGGTGCCAACGCCTACTACCTGTGGAACGCCCACTGGGAGCACTGGTCGCA
TATGCCCCCGCTGGAGGAGCGCGTTGAGTACCCATACCAGAACATTCGCACCAAGAACTTTCCGTGGGGCGATGG
CGACAAGGTGAGTTTCTCGATCTCATTTACCGAGAAGTGGTGACGGTCGATGGCTGACGGAGTGATAGACGCTCT
TGTAAGTGCCGGCTGATACGGGCTGGGGATTAAGCCGTGACGCGATCAAATTCGAACGGCGGAGTAGAAGATTCG
AATGCTAACGCGCGGAAACAGCTGGAACGACAGTGTCAACTACCACAACAAGGACAAGACTTCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail