Protein ID | Hirsu2|2079 |
Gene name | |
Location | Contig_1486:3981..5672 |
Strand | + |
Gene length (bp) | 1691 |
Transcript length (bp) | 1542 |
Coding sequence length (bp) | 1542 |
Protein length (aa) | 514 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF09173 | eIF2_C | Initiation factor eIF2 gamma, C terminal | 2.9E-31 | 414 | 502 |
PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 1.6E-20 | 85 | 288 |
PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 3.3E-09 | 320 | 402 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P32481|IF2G_YEAST | Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD11 PE=1 SV=1 | 58 | 510 | 0.0E+00 |
sp|Q09130|IF2G_SCHPO | Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif213 PE=2 SV=1 | 65 | 509 | 0.0E+00 |
sp|Q24208|IF2G_DROME | Eukaryotic translation initiation factor 2 subunit 3 OS=Drosophila melanogaster GN=eIF-2gamma PE=2 SV=1 | 61 | 510 | 0.0E+00 |
sp|Q54XD8|IF2G_DICDI | Eukaryotic translation initiation factor 2 subunit 3 OS=Dictyostelium discoideum GN=eif2s3 PE=2 SV=1 | 52 | 508 | 0.0E+00 |
sp|Q2KHU8|IF2G_BOVIN | Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus GN=EIF2S3 PE=2 SV=1 | 52 | 511 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P32481|IF2G_YEAST | Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD11 PE=1 SV=1 | 58 | 510 | 0.0E+00 |
sp|Q09130|IF2G_SCHPO | Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif213 PE=2 SV=1 | 65 | 509 | 0.0E+00 |
sp|Q24208|IF2G_DROME | Eukaryotic translation initiation factor 2 subunit 3 OS=Drosophila melanogaster GN=eIF-2gamma PE=2 SV=1 | 61 | 510 | 0.0E+00 |
sp|Q54XD8|IF2G_DICDI | Eukaryotic translation initiation factor 2 subunit 3 OS=Dictyostelium discoideum GN=eif2s3 PE=2 SV=1 | 52 | 508 | 0.0E+00 |
sp|Q2KHU8|IF2G_BOVIN | Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus GN=EIF2S3 PE=2 SV=1 | 52 | 511 | 0.0E+00 |
sp|P81795|IF2G_RAT | Eukaryotic translation initiation factor 2 subunit 3 OS=Rattus norvegicus GN=Eif2s3 PE=1 SV=2 | 52 | 511 | 0.0E+00 |
sp|P41091|IF2G_HUMAN | Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens GN=EIF2S3 PE=1 SV=3 | 52 | 511 | 0.0E+00 |
sp|Q9Z0N1|IF2G_MOUSE | Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus GN=Eif2s3x PE=1 SV=2 | 52 | 511 | 0.0E+00 |
sp|Q5R797|IF2G_PONAB | Eukaryotic translation initiation factor 2 subunit 3 OS=Pongo abelii GN=EIF2S3 PE=2 SV=1 | 52 | 511 | 0.0E+00 |
sp|Q5ZMS3|IF2G_CHICK | Eukaryotic translation initiation factor 2 subunit 3 OS=Gallus gallus GN=EIF2S3 PE=1 SV=1 | 52 | 511 | 0.0E+00 |
sp|Q9Z0N2|IF2H_MOUSE | Eukaryotic translation initiation factor 2 subunit 3, Y-linked OS=Mus musculus GN=Eif2s3y PE=1 SV=2 | 52 | 511 | 0.0E+00 |
sp|Q2VIR3|IF2GL_HUMAN | Putative eukaryotic translation initiation factor 2 subunit 3-like protein OS=Homo sapiens GN=EIF2S3L PE=5 SV=2 | 52 | 511 | 0.0E+00 |
sp|O96719|IF2G_ENCCU | Eukaryotic translation initiation factor 2 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0700 PE=3 SV=2 | 78 | 510 | 1.0E-160 |
sp|Q58657|IF2G_METJA | Translation initiation factor 2 subunit gamma OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eif2g PE=1 SV=2 | 81 | 502 | 8.0E-131 |
sp|A6UPK8|IF2G_METVS | Translation initiation factor 2 subunit gamma OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=eif2g PE=3 SV=1 | 79 | 502 | 4.0E-127 |
sp|Q6LXY6|IF2G_METMP | Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain S2 / LL) GN=eif2g PE=3 SV=1 | 81 | 502 | 7.0E-127 |
sp|A6VGE8|IF2G_METM7 | Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eif2g PE=3 SV=1 | 81 | 502 | 6.0E-126 |
sp|A4FWW9|IF2G_METM5 | Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eif2g PE=3 SV=1 | 81 | 502 | 1.0E-125 |
sp|A9AAA4|IF2G_METM6 | Translation initiation factor 2 subunit gamma OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=eif2g PE=3 SV=1 | 81 | 502 | 3.0E-125 |
sp|Q9Y9C1|IF2G_AERPE | Translation initiation factor 2 subunit gamma OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=eif2g PE=3 SV=2 | 82 | 502 | 3.0E-121 |
sp|Q8U082|IF2G_PYRFU | Translation initiation factor 2 subunit gamma OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eif2g PE=1 SV=1 | 81 | 502 | 6.0E-121 |
sp|Q9V1G0|IF2G_PYRAB | Translation initiation factor 2 subunit gamma OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eif2g PE=1 SV=1 | 81 | 502 | 2.0E-119 |
sp|O59410|IF2G_PYRHO | Translation initiation factor 2 subunit gamma OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eif2g PE=3 SV=1 | 81 | 502 | 1.0E-118 |
sp|Q8TJT7|IF2G_METAC | Translation initiation factor 2 subunit gamma OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eif2g PE=3 SV=1 | 83 | 504 | 3.0E-118 |
sp|Q8PZA0|IF2G_METMA | Translation initiation factor 2 subunit gamma OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eif2g PE=3 SV=1 | 83 | 504 | 3.0E-118 |
sp|O29663|IF2G_ARCFU | Translation initiation factor 2 subunit gamma OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eif2g PE=3 SV=1 | 64 | 502 | 6.0E-115 |
sp|A6UTL4|IF2G_META3 | Translation initiation factor 2 subunit gamma OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eif2g PE=3 SV=1 | 82 | 502 | 6.0E-114 |
sp|Q975N8|IF2G_SULTO | Translation initiation factor 2 subunit gamma OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=eif2g PE=3 SV=2 | 83 | 502 | 9.0E-113 |
sp|B6YW69|IF2G_THEON | Translation initiation factor 2 subunit gamma OS=Thermococcus onnurineus (strain NA1) GN=eif2g PE=3 SV=1 | 82 | 502 | 5.0E-112 |
sp|Q8TVE5|IF2G_METKA | Translation initiation factor 2 subunit gamma OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eif2g PE=3 SV=1 | 82 | 502 | 9.0E-112 |
sp|Q5JDL3|IF2G_THEKO | Translation initiation factor 2 subunit gamma OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eif2g PE=3 SV=1 | 82 | 502 | 1.0E-111 |
sp|Q980A5|IF2G_SULSO | Translation initiation factor 2 subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eif2g PE=1 SV=1 | 83 | 502 | 3.0E-108 |
sp|O26361|IF2G_METTH | Translation initiation factor 2 subunit gamma OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eif2g PE=3 SV=1 | 83 | 502 | 1.0E-107 |
sp|Q978W8|IF2G_THEVO | Translation initiation factor 2 subunit gamma OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=eif2g PE=3 SV=1 | 83 | 504 | 3.0E-102 |
sp|Q9HNK9|IF2G_HALSA | Translation initiation factor 2 subunit gamma OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eif2g PE=3 SV=1 | 82 | 502 | 1.0E-101 |
sp|B0R6Y7|IF2G_HALS3 | Translation initiation factor 2 subunit gamma OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eif2g PE=3 SV=1 | 82 | 502 | 1.0E-101 |
sp|B9LSM6|IF2G_HALLT | Translation initiation factor 2 subunit gamma OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=eif2g PE=3 SV=1 | 83 | 503 | 3.0E-101 |
sp|Q18KI6|IF2G_HALWD | Translation initiation factor 2 subunit gamma OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=eif2g PE=3 SV=1 | 82 | 502 | 3.0E-99 |
sp|Q9HLA7|IF2G_THEAC | Translation initiation factor 2 subunit gamma OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=eif2g PE=3 SV=1 | 83 | 504 | 4.0E-99 |
sp|Q5UYS2|IF2G_HALMA | Translation initiation factor 2 subunit gamma OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=eif2g PE=3 SV=1 | 82 | 502 | 8.0E-96 |
sp|Q3IMM5|IF2G_NATPD | Translation initiation factor 2 subunit gamma OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=eif2g PE=3 SV=1 | 82 | 502 | 1.0E-95 |
sp|O36041|IF2G_SPIVO | Eukaryotic translation initiation factor 2 subunit gamma (Fragment) OS=Spironucleus vortens PE=3 SV=1 | 91 | 305 | 5.0E-59 |
sp|Q46455|SELB_MOOTH | Selenocysteine-specific elongation factor OS=Moorella thermoacetica GN=selB PE=1 SV=1 | 86 | 347 | 2.0E-26 |
sp|P45975|SUV39_DROME | Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster GN=Su(var)3-9 PE=1 SV=2 | 61 | 125 | 8.0E-25 |
sp|Q294B9|SUV39_DROPS | Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila pseudoobscura pseudoobscura GN=Su(var)3-9 PE=3 SV=1 | 61 | 125 | 1.0E-24 |
sp|B6YQ04|EFTU_AZOPC | Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-21 |
sp|B3PMU1|EFTU_MYCA5 | Elongation factor Tu OS=Mycoplasma arthritidis (strain 158L3-1) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-20 |
sp|P33165|EFTU_BACFR | Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-20 |
sp|Q5L890|EFTU_BACFN | Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-20 |
sp|B2RL52|EFTU_PORG3 | Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-20 |
sp|Q46497|SELB_DESBA | Selenocysteine-specific elongation factor OS=Desulfomicrobium baculatum GN=selB PE=3 SV=1 | 88 | 342 | 9.0E-20 |
sp|Q2NJ20|EFTU_AYWBP | Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 | 78 | 340 | 2.0E-19 |
sp|C4KZP9|EFTU_EXISA | Elongation factor Tu OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=tuf PE=3 SV=1 | 86 | 429 | 3.0E-19 |
sp|Q6YQV8|EFTU_ONYPE | Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 | 78 | 340 | 3.0E-19 |
sp|Q1H4N9|EFTU2_METFK | Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 | 86 | 340 | 3.0E-19 |
sp|Q1H4Q1|EFTU1_METFK | Elongation factor Tu 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf1 PE=3 SV=1 | 86 | 340 | 4.0E-19 |
sp|Q9TMM9|EFTU_TOXGO | Elongation factor Tu, apicoplast OS=Toxoplasma gondii GN=tufA PE=3 SV=1 | 75 | 348 | 4.0E-19 |
sp|B3QY22|EFTU_CHLT3 | Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 | 86 | 342 | 6.0E-19 |
sp|Q12SW1|EFTU_SHEDO | Elongation factor Tu OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tuf PE=3 SV=1 | 82 | 340 | 7.0E-19 |
sp|Q6MU81|EFTU_MYCMS | Elongation factor Tu OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=tuf PE=3 SV=1 | 86 | 382 | 8.0E-19 |
sp|Q2SSW8|EFTU_MYCCT | Elongation factor Tu OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=tuf PE=3 SV=1 | 86 | 382 | 8.0E-19 |
sp|P22679|EFTU_MYCHP | Elongation factor Tu OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=tuf PE=1 SV=1 | 86 | 340 | 8.0E-19 |
sp|Q21M86|EFTU_SACD2 | Elongation factor Tu OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=tuf1 PE=3 SV=1 | 86 | 358 | 9.0E-19 |
sp|Q1IHG6|EFTU_KORVE | Elongation factor Tu OS=Koribacter versatilis (strain Ellin345) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-18 |
sp|Q8EX18|EFTU_MYCPE | Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 | 83 | 340 | 1.0E-18 |
sp|Q98QG1|EFTU_MYCPU | Elongation factor Tu OS=Mycoplasma pulmonis (strain UAB CTIP) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-18 |
sp|A5FIJ9|EFTU_FLAJ1 | Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-18 |
sp|Q0I0B9|EFTU1_SHESR | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|Q0HNV1|EFTU1_SHESM | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|Q5HVZ7|EFTU_CAMJR | Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|A1VYI6|EFTU_CAMJJ | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|O69303|EFTU_CAMJE | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|A7H4R3|EFTU_CAMJD | Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|A8FKQ5|EFTU_CAMJ8 | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|Q0I0A7|EFTU2_SHESR | Elongation factor Tu 2 OS=Shewanella sp. (strain MR-7) GN=tuf2 PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|B9KFF9|EFTU_CAMLR | Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|Q661E5|EFTU_BORBP | Elongation factor Tu OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=tuf PE=3 SV=1 | 75 | 340 | 2.0E-18 |
sp|B1YGU8|EFTU_EXIS2 | Elongation factor Tu OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|Q3BWY6|EFTU_XANC5 | Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|Q8NL22|EFTU_XANAC | Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 | 86 | 340 | 2.0E-18 |
sp|A6KYK9|EFTU_BACV8 | Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-18 |
sp|C5BQ44|EFTU_TERTT | Elongation factor Tu OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-18 |
sp|A6Q1L5|EFTU_NITSB | Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-18 |
sp|B5RPI0|EFTU_BORRA | Elongation factor Tu OS=Borrelia recurrentis (strain A1) GN=tuf PE=3 SV=1 | 75 | 340 | 3.0E-18 |
sp|B5RM34|EFTU_BORDL | Elongation factor Tu OS=Borrelia duttonii (strain Ly) GN=tuf PE=3 SV=1 | 75 | 340 | 3.0E-18 |
sp|Q6F0J5|EFTU_MESFL | Elongation factor Tu OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=tuf PE=3 SV=1 | 86 | 371 | 3.0E-18 |
sp|A5GIP0|EFTU_SYNPW | Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-18 |
sp|B7J241|EFTU_BORBZ | Elongation factor Tu OS=Borrelia burgdorferi (strain ZS7) GN=tuf PE=3 SV=1 | 75 | 340 | 4.0E-18 |
sp|P50062|EFTU_BORBU | Elongation factor Tu OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=tuf PE=3 SV=1 | 75 | 340 | 4.0E-18 |
sp|A5EX84|EFTU_DICNV | Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1 | 86 | 358 | 4.0E-18 |
sp|B0RU96|EFTU2_XANCB | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf2 PE=3 SV=1 | 86 | 340 | 4.0E-18 |
sp|Q4URC5|EFTU2_XANC8 | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf2 PE=3 SV=1 | 86 | 340 | 4.0E-18 |
sp|Q8PC59|EFTU1_XANCP | Elongation factor Tu-A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufA PE=3 SV=1 | 86 | 340 | 4.0E-18 |
sp|Q8PC51|EFTU2_XANCP | Elongation factor Tu-B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufB PE=3 SV=1 | 86 | 340 | 4.0E-18 |
sp|Q4URD7|EFTU1_XANC8 | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf1 PE=3 SV=1 | 86 | 340 | 4.0E-18 |
sp|A6LE88|EFTU_PARD8 | Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-18 |
sp|Q0SN31|EFTU_BORAP | Elongation factor Tu OS=Borrelia afzelii (strain PKo) GN=tuf PE=3 SV=1 | 75 | 340 | 5.0E-18 |
sp|P50371|EFTU_CHACO | Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 | 75 | 429 | 7.0E-18 |
sp|Q8A463|EFTU_BACTN | Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-18 |
sp|Q01SX2|EFTU_SOLUE | Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 | 86 | 340 | 9.0E-18 |
sp|Q4A9G1|EFTU_MYCHJ | Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=tuf PE=3 SV=1 | 86 | 340 | 9.0E-18 |
sp|B0RU84|EFTU1_XANCB | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf1 PE=3 SV=1 | 86 | 340 | 9.0E-18 |
sp|A0KRL0|EFTU_SHESA | Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|A5GW14|EFTU_SYNR3 | Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q4MYA4|EFTU_THEPA | Elongation factor Tu, apicoplast OS=Theileria parva GN=tufA PE=3 SV=1 | 78 | 509 | 1.0E-17 |
sp|Q492B2|EFTU_BLOPB | Elongation factor Tu OS=Blochmannia pennsylvanicus (strain BPEN) GN=tuf PE=3 SV=1 | 86 | 358 | 1.0E-17 |
sp|Q5GWR8|EFTU_XANOR | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q2NZX1|EFTU_XANOM | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q3Z7S9|EFTU_DEHM1 | Elongation factor Tu OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=tuf PE=3 SV=1 | 87 | 429 | 1.0E-17 |
sp|Q089R8|EFTU1_SHEFN | Elongation factor Tu 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q8EK81|EFTU1_SHEON | Elongation factor Tu 1 OS=Shewanella oneidensis (strain MR-1) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q089Q6|EFTU2_SHEFN | Elongation factor Tu 2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q8EK70|EFTU2_SHEON | Elongation factor Tu 2 OS=Shewanella oneidensis (strain MR-1) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q4A7K0|EFTU_MYCH7 | Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 7448) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q600B6|EFTU_MYCH2 | Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 232) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|Q0HNT9|EFTU2_SHESM | Elongation factor Tu 2 OS=Shewanella sp. (strain MR-4) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-17 |
sp|A0ALY8|EFTU_LISW6 | Elongation factor Tu OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=tuf PE=3 SV=1 | 86 | 336 | 1.0E-17 |
sp|Q8Y422|EFTU_LISMO | Elongation factor Tu OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tuf PE=1 SV=1 | 86 | 336 | 1.0E-17 |
sp|Q71WB9|EFTU_LISMF | Elongation factor Tu OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tuf PE=3 SV=1 | 86 | 336 | 1.0E-17 |
sp|C1KZK6|EFTU_LISMC | Elongation factor Tu OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=tuf PE=3 SV=1 | 86 | 336 | 1.0E-17 |
sp|P50068|EFTU_UREPA | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-17 |
sp|B1AJG3|EFTU_UREP2 | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-17 |
sp|Q3ZXX3|EFTU_DEHMC | Elongation factor Tu OS=Dehalococcoides mccartyi (strain CBDB1) GN=tuf PE=3 SV=1 | 87 | 429 | 2.0E-17 |
sp|A5FQQ5|EFTU_DEHMB | Elongation factor Tu OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=tuf PE=3 SV=1 | 87 | 429 | 2.0E-17 |
sp|Q3AMT6|EFTU_SYNSC | Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-17 |
sp|A9ETD1|EFTU_SORC5 | Elongation factor Tu OS=Sorangium cellulosum (strain So ce56) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-17 |
sp|P42476|EFTU_TERFE | Elongation factor Tu OS=Terrimonas ferruginea GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-17 |
sp|B2S0H9|EFTU_BORHD | Elongation factor Tu OS=Borrelia hermsii (strain HS1 / DAH) GN=tuf PE=3 SV=1 | 75 | 340 | 2.0E-17 |
sp|A7ZCN0|EFTU_CAMC1 | Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-17 |
sp|A1QZR2|EFTU_BORT9 | Elongation factor Tu OS=Borrelia turicatae (strain 91E135) GN=tuf PE=3 SV=1 | 75 | 340 | 2.0E-17 |
sp|Q7N9B1|EFTU1_PHOLL | Elongation factor Tu 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tuf1 PE=3 SV=1 | 82 | 358 | 2.0E-17 |
sp|Q6A6L7|EFTU_PROAC | Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-17 |
sp|Q2S1P8|EFTU_SALRD | Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 | 75 | 340 | 3.0E-17 |
sp|P42481|EFTU_THIDL | Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-17 |
sp|A5IYA9|EFTU_MYCAP | Elongation factor Tu OS=Mycoplasma agalactiae (strain PG2) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-17 |
sp|Q7V500|EFTU_PROMM | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-17 |
sp|Q13TF5|EFTU_BURXL | Elongation factor Tu OS=Burkholderia xenovorans (strain LB400) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-17 |
sp|A1TJ05|EFTU_ACIAC | Elongation factor Tu OS=Acidovorax citrulli (strain AAC00-1) GN=tuf1 PE=3 SV=1 | 86 | 358 | 3.0E-17 |
sp|B5Z8K3|EFTU_HELPG | Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-17 |
sp|Q2L2G6|EFTU_BORA1 | Elongation factor Tu OS=Bordetella avium (strain 197N) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-17 |
sp|A7GZK6|EFTU_CAMC5 | Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-17 |
sp|A3Q968|EFTU1_SHELP | Elongation factor Tu 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tuf1 PE=3 SV=1 | 86 | 358 | 3.0E-17 |
sp|B6JN44|EFTU_HELP2 | Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-17 |
sp|P42480|EFTU_HYMOC | Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-17 |
sp|Q2LQA3|EFTU_SYNAS | Elongation factor Tu OS=Syntrophus aciditrophicus (strain SB) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-17 |
sp|Q1ACI3|EFTU_CHAVU | Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 | 86 | 429 | 4.0E-17 |
sp|A7I3U7|EFTU_CAMHC | Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-17 |
sp|P56003|EFTU_HELPY | Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-17 |
sp|B2UUW8|EFTU_HELPS | Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|P42474|EFTU_CELLY | Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|A9KW88|EFTU1_SHEB9 | Elongation factor Tu 1 OS=Shewanella baltica (strain OS195) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|A1S204|EFTU_SHEAM | Elongation factor Tu OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tuf1 PE=3 SV=1 | 86 | 358 | 5.0E-17 |
sp|A2CC87|EFTU_PROM3 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|A6WHR4|EFTU_SHEB8 | Elongation factor Tu OS=Shewanella baltica (strain OS185) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|A9KWA0|EFTU2_SHEB9 | Elongation factor Tu 2 OS=Shewanella baltica (strain OS195) GN=tuf2 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|A3DBA0|EFTU2_SHEB5 | Elongation factor Tu 2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tuf2 PE=3 SV=2 | 86 | 340 | 5.0E-17 |
sp|A3DA74|EFTU1_SHEB5 | Elongation factor Tu 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|B3WE38|EFTU_LACCB | Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 | 86 | 371 | 5.0E-17 |
sp|Q039K9|EFTU_LACC3 | Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 | 86 | 371 | 5.0E-17 |
sp|Q7TT91|EFTU_BORPE | Elongation factor Tu OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|Q79GC6|EFTU_BORPA | Elongation factor Tu OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|Q79G84|EFTU_BORBR | Elongation factor Tu OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|B5ZC31|EFTU_UREU1 | Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|A1VIP8|EFTU_POLNA | Elongation factor Tu OS=Polaromonas naphthalenivorans (strain CJ2) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-17 |
sp|Q72GW4|EFTU_THET2 | Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 | 78 | 340 | 5.0E-17 |
sp|Q7MYE8|EFTU2_PHOLL | Elongation factor Tu 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tuf2 PE=3 SV=1 | 86 | 358 | 5.0E-17 |
sp|Q04B37|EFTU_LACDB | Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 | 86 | 371 | 5.0E-17 |
sp|Q1GAQ0|EFTU_LACDA | Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 | 86 | 371 | 5.0E-17 |
sp|Q33451|EFTU_EIMTE | Elongation factor Tu, apicoplast OS=Eimeria tenella GN=tufA PE=3 SV=1 | 86 | 340 | 6.0E-17 |
sp|A8EW02|EFTU_ARCB4 | Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 | 86 | 340 | 6.0E-17 |
sp|A7Z0N5|EFTU_BACMF | Elongation factor Tu OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tuf PE=3 SV=1 | 87 | 429 | 6.0E-17 |
sp|Q7VRP0|EFTU_BLOFL | Elongation factor Tu OS=Blochmannia floridanus GN=tuf PE=3 SV=1 | 86 | 358 | 6.0E-17 |
sp|B8DAY7|EFTU_LISMH | Elongation factor Tu OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=tuf PE=3 SV=1 | 86 | 336 | 6.0E-17 |
sp|Q927I6|EFTU_LISIN | Elongation factor Tu OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tuf PE=3 SV=1 | 86 | 336 | 6.0E-17 |
sp|Q2SU25|EFTU_BURTA | Elongation factor Tu OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|Q63PZ6|EFTU_BURPS | Elongation factor Tu OS=Burkholderia pseudomallei (strain K96243) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|A3NEI1|EFTU_BURP6 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 668) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|Q3JMP6|EFTU_BURP1 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 1710b) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|A3P0B5|EFTU_BURP0 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 1106a) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|A1V8A5|EFTU_BURMS | Elongation factor Tu OS=Burkholderia mallei (strain SAVP1) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|Q62GK3|EFTU_BURMA | Elongation factor Tu OS=Burkholderia mallei (strain ATCC 23344) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|A2S7F9|EFTU_BURM9 | Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10229) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|A3MRT8|EFTU_BURM7 | Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10247) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|Q11Q98|EFTU_CYTH3 | Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|A3Q980|EFTU2_SHELP | Elongation factor Tu 2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tuf2 PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|B8I5N8|EFTU_CLOCE | Elongation factor Tu OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-17 |
sp|Q39KI2|EFTU_BURL3 | Elongation factor Tu OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tuf1 PE=3 SV=1 | 86 | 340 | 8.0E-17 |
sp|Q0BJ48|EFTU_BURCM | Elongation factor Tu OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tuf1 PE=3 SV=1 | 86 | 340 | 8.0E-17 |
sp|A0K3L0|EFTU_BURCH | Elongation factor Tu OS=Burkholderia cenocepacia (strain HI2424) GN=tuf1 PE=3 SV=1 | 86 | 340 | 8.0E-17 |
sp|Q1BRT3|EFTU_BURCA | Elongation factor Tu OS=Burkholderia cenocepacia (strain AU 1054) GN=tuf1 PE=3 SV=1 | 86 | 340 | 8.0E-17 |
sp|A8G1F0|EFTU_SHESH | Elongation factor Tu OS=Shewanella sediminis (strain HAW-EB3) GN=tuf PE=3 SV=1 | 86 | 358 | 8.0E-17 |
sp|Q20EU5|EFTU_OLTVI | Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1 | 86 | 340 | 8.0E-17 |
sp|Q8XGZ0|EFTU_RALSO | Elongation factor Tu OS=Ralstonia solanacearum (strain GMI1000) GN=tufA PE=3 SV=1 | 86 | 340 | 9.0E-17 |
sp|Q9TKZ5|EFTU_NEPOL | Elongation factor Tu, chloroplastic OS=Nephroselmis olivacea GN=tufA PE=3 SV=1 | 86 | 340 | 9.0E-17 |
sp|P33169|EFTU_SHEPU | Elongation factor Tu OS=Shewanella putrefaciens GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-16 |
sp|A4YBY5|EFTU_SHEPC | Elongation factor Tu OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-16 |
sp|A0RQJ3|EFTU_CAMFF | Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-16 |
sp|A4JAM5|EFTU_BURVG | Elongation factor Tu OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-16 |
sp|Q7U4D1|EFTU_SYNPX | Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-16 |
sp|Q9ZK19|EFTU_HELPJ | Elongation factor Tu OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-16 |
sp|Q748X8|EFTU_GEOSL | Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-16 |
sp|A1SNN5|EFTU_NOCSJ | Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 | 86 | 429 | 1.0E-16 |
sp|B0TM14|EFTU_SHEHH | Elongation factor Tu OS=Shewanella halifaxensis (strain HAW-EB4) GN=tuf1 PE=3 SV=1 | 86 | 358 | 1.0E-16 |
sp|Q123F6|EFTU_POLSJ | Elongation factor Tu OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tuf1 PE=3 SV=1 | 86 | 358 | 1.0E-16 |
sp|P60339|EFTU2_THET8 | Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 | 78 | 340 | 1.0E-16 |
sp|B3ETZ7|EFTU_AMOA5 | Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 | 86 | 371 | 2.0E-16 |
sp|Q21SF0|EFTU1_RHOFT | Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 | 86 | 358 | 2.0E-16 |
sp|Q21RV6|EFTU2_RHOFT | Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 | 86 | 358 | 2.0E-16 |
sp|Q3B6G3|EFTU_CHLL7 | Elongation factor Tu OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|A5D5I8|EFTU2_PELTS | Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|Q01698|EFTU_THEAQ | Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 | 78 | 340 | 2.0E-16 |
sp|Q0K5Z9|EFTU_CUPNH | Elongation factor Tu OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|A8F982|EFTU_BACP2 | Elongation factor Tu OS=Bacillus pumilus (strain SAFR-032) GN=tuf PE=3 SV=1 | 87 | 429 | 2.0E-16 |
sp|Q6KI66|EFTU_MYCMO | Elongation factor Tu OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|P42473|EFTU_CHLP8 | Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|Q5QWA3|EFTU_IDILO | Elongation factor Tu OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|A9BCK0|EFTU_PROM4 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|Q02WY9|EFTU_LACLS | Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|A2RMT1|EFTU_LACLM | Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|Q9CEI0|EFTU_LACLA | Elongation factor Tu OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|B9E8Q0|EFTU_MACCJ | Elongation factor Tu OS=Macrococcus caseolyticus (strain JCSC5402) GN=tuf PE=3 SV=1 | 87 | 429 | 2.0E-16 |
sp|A4SUU7|EFTU_POLSQ | Elongation factor Tu OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|P33167|EFTU_BURCE | Elongation factor Tu OS=Burkholderia cepacia GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-16 |
sp|O66429|EFTU_AQUAE | Elongation factor Tu OS=Aquifex aeolicus (strain VF5) GN=tufA PE=3 SV=1 | 86 | 386 | 3.0E-16 |
sp|O50293|EFTU_AQUPY | Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 | 86 | 386 | 3.0E-16 |
sp|P60338|EFTU1_THETH | Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 | 78 | 340 | 3.0E-16 |
sp|Q5SHN6|EFTU1_THET8 | Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 | 78 | 340 | 3.0E-16 |
sp|Q46WC7|EFTU_CUPPJ | Elongation factor Tu OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|A0LRL8|EFTU_ACIC1 | Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|Q1LI13|EFTU_CUPMC | Elongation factor Tu OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|A5F3K0|EFTU_VIBC3 | Elongation factor Tu OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|Q9KUZ6|EFTU2_VIBCH | Elongation factor Tu-B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tufB PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|Q15NP2|EFTU_PSEA6 | Elongation factor Tu OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|Q7MH43|EFTU1_VIBVY | Elongation factor Tu 1 OS=Vibrio vulnificus (strain YJ016) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|P64029|EFTU_STAAW | Elongation factor Tu OS=Staphylococcus aureus (strain MW2) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|A8YZP5|EFTU_STAAT | Elongation factor Tu OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|Q6GBT9|EFTU_STAAS | Elongation factor Tu OS=Staphylococcus aureus (strain MSSA476) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|Q6GJC0|EFTU_STAAR | Elongation factor Tu OS=Staphylococcus aureus (strain MRSA252) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|P99152|EFTU_STAAN | Elongation factor Tu OS=Staphylococcus aureus (strain N315) GN=tuf PE=1 SV=1 | 87 | 429 | 3.0E-16 |
sp|P64028|EFTU_STAAM | Elongation factor Tu OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|A6QEK0|EFTU_STAAE | Elongation factor Tu OS=Staphylococcus aureus (strain Newman) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|Q5HIC7|EFTU_STAAC | Elongation factor Tu OS=Staphylococcus aureus (strain COL) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|Q2YSB3|EFTU_STAAB | Elongation factor Tu OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|A5IQA2|EFTU_STAA9 | Elongation factor Tu OS=Staphylococcus aureus (strain JH9) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|Q2G0N0|EFTU_STAA8 | Elongation factor Tu OS=Staphylococcus aureus (strain NCTC 8325) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|Q2FJ92|EFTU_STAA3 | Elongation factor Tu OS=Staphylococcus aureus (strain USA300) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|A6TZ25|EFTU_STAA2 | Elongation factor Tu OS=Staphylococcus aureus (strain JH1) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|A7WYX6|EFTU_STAA1 | Elongation factor Tu OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tuf PE=3 SV=1 | 87 | 429 | 3.0E-16 |
sp|Q2NQL7|EFTU_SODGM | Elongation factor Tu OS=Sodalis glossinidius (strain morsitans) GN=tuf1 PE=3 SV=1 | 86 | 358 | 3.0E-16 |
sp|A3PEZ7|EFTU_PROM0 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|Q38WR7|EFTU_LACSS | Elongation factor Tu OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|P42477|EFTU_HERAU | Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-16 |
sp|A8G708|EFTU_PROM2 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-16 |
sp|B1ZPC5|EFTU_OPITP | Elongation factor Tu OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-16 |
sp|P02992|EFTU_YEAST | Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 | 86 | 429 | 4.0E-16 |
sp|Q49V58|EFTU_STAS1 | Elongation factor Tu OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tuf PE=3 SV=1 | 87 | 429 | 4.0E-16 |
sp|Q8D240|EFTU_WIGBR | Elongation factor Tu OS=Wigglesworthia glossinidia brevipalpis GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-16 |
sp|P72231|EFTU_PLARO | Elongation factor Tu OS=Planobispora rosea GN=tuf PE=3 SV=2 | 86 | 363 | 4.0E-16 |
sp|A6W394|EFTU_MARMS | Elongation factor Tu OS=Marinomonas sp. (strain MWYL1) GN=tuf PE=3 SV=1 | 86 | 358 | 4.0E-16 |
sp|B3E156|EFTU_METI4 | Elongation factor Tu OS=Methylacidiphilum infernorum (isolate V4) GN=tuf PE=3 SV=1 | 79 | 340 | 4.0E-16 |
sp|A2BYN4|EFTU_PROM5 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-16 |
sp|A8GYW2|EFTU_SHEPA | Elongation factor Tu OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tuf1 PE=3 SV=1 | 86 | 358 | 4.0E-16 |
sp|Q839G8|EFTU_ENTFA | Elongation factor Tu OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tuf PE=3 SV=1 | 83 | 371 | 4.0E-16 |
sp|B2UQY9|EFTU_AKKM8 | Elongation factor Tu OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-16 |
sp|A2BT83|EFTU_PROMS | Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-16 |
sp|A2CI56|EFTU_CHLAT | Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 | 86 | 429 | 5.0E-16 |
sp|Q74JU6|EFTU_LACJO | Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 | 86 | 371 | 5.0E-16 |
sp|A5DN78|EFTU_PICGU | Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 | 86 | 340 | 5.0E-16 |
sp|A6T3K6|EFTU_JANMA | Elongation factor Tu OS=Janthinobacterium sp. (strain Marseille) GN=tuf1 PE=3 SV=1 | 86 | 358 | 5.0E-16 |
sp|C5D3R5|EFTU_GEOSW | Elongation factor Tu OS=Geobacillus sp. (strain WCH70) GN=tuf PE=3 SV=1 | 82 | 371 | 5.0E-16 |
sp|P85834|EFTU_RAT | Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 | 86 | 340 | 5.0E-16 |
sp|C0ZIH6|EFTU_BREBN | Elongation factor Tu OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-16 |
sp|Q65QG6|EFTU_MANSM | Elongation factor Tu OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-16 |
sp|A5D5K0|EFTU1_PELTS | Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-16 |
sp|Q5GSU2|EFTU1_WOLTR | Elongation factor Tu 1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-16 |
sp|Q9ZT91|EFTM_ARATH | Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 | 86 | 429 | 5.0E-16 |
sp|B3QZH5|EFTU_PHYMT | Elongation factor Tu OS=Phytoplasma mali (strain AT) GN=tuf PE=3 SV=1 | 86 | 340 | 6.0E-16 |
sp|Q8BFR5|EFTU_MOUSE | Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 | 86 | 340 | 6.0E-16 |
sp|B4RYQ8|EFTU_ALTMD | Elongation factor Tu OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tuf1 PE=3 SV=1 | 86 | 358 | 6.0E-16 |
sp|A4SCQ7|EFTU_CHLPM | Elongation factor Tu OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tuf PE=3 SV=1 | 86 | 340 | 6.0E-16 |
sp|Q9JHW4|SELB_MOUSE | Selenocysteine-specific elongation factor OS=Mus musculus GN=Eefsec PE=1 SV=2 | 81 | 391 | 6.0E-16 |
sp|Q318N5|EFTU_PROM9 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 | 86 | 340 | 6.0E-16 |
sp|Q6MDN0|EFTU_PARUW | Elongation factor Tu OS=Protochlamydia amoebophila (strain UWE25) GN=tuf PE=3 SV=1 | 86 | 340 | 6.0E-16 |
sp|A5CW32|EFTU_VESOH | Elongation factor Tu OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tuf1 PE=3 SV=1 | 86 | 371 | 6.0E-16 |
sp|Q5GRY3|EFTU2_WOLTR | Elongation factor Tu 2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-16 |
sp|P33166|EFTU_BACSU | Elongation factor Tu OS=Bacillus subtilis (strain 168) GN=tuf PE=3 SV=1 | 87 | 429 | 6.0E-16 |
sp|Q1MPT8|EFTU_LAWIP | Elongation factor Tu OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q042T5|EFTU_LACGA | Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 | 86 | 371 | 7.0E-16 |
sp|Q4A597|EFTU_MYCS5 | Elongation factor Tu OS=Mycoplasma synoviae (strain 53) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q8R7T8|EFTU2_CALS4 | Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q1D776|EFTU2_MYXXD | Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q5L5H6|EFTU_CHLAB | Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q1D7V1|EFTU1_MYXXD | Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q8DCQ7|EFTU2_VIBVU | Elongation factor Tu 2 OS=Vibrio vulnificus (strain CMCP6) GN=tuf2 PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q7MGR1|EFTU2_VIBVY | Elongation factor Tu 2 OS=Vibrio vulnificus (strain YJ016) GN=tuf2 PE=3 SV=2 | 86 | 340 | 7.0E-16 |
sp|Q8DD27|EFTU1_VIBVU | Elongation factor Tu 1 OS=Vibrio vulnificus (strain CMCP6) GN=tuf1 PE=3 SV=2 | 86 | 340 | 7.0E-16 |
sp|Q3A9R3|EFTU1_CARHZ | Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-16 |
sp|Q255F3|EFTU_CHLFF | Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-16 |
sp|A1T056|EFTU_PSYIN | Elongation factor Tu OS=Psychromonas ingrahamii (strain 37) GN=tuf PE=3 SV=1 | 82 | 340 | 8.0E-16 |
sp|A8F2E9|EFTU_RICM5 | Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 | 86 | 358 | 8.0E-16 |
sp|Q8KTA3|EFTU_RICRH | Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 | 86 | 358 | 8.0E-16 |
sp|A2C4U5|EFTU_PROM1 | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 | 86 | 340 | 9.0E-16 |
sp|Q39Y08|EFTU_GEOMG | Elongation factor Tu OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tuf1 PE=3 SV=1 | 86 | 340 | 9.0E-16 |
sp|Q3A9P8|EFTU2_CARHZ | Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 | 86 | 340 | 9.0E-16 |
sp|P18906|EFTU_MYCGA | Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 | 86 | 340 | 9.0E-16 |
sp|Q1XDK1|EFTU_PYRYE | Elongation factor Tu, chloroplastic OS=Pyropia yezoensis GN=tufA PE=3 SV=1 | 86 | 340 | 9.0E-16 |
sp|P57772|SELB_HUMAN | Selenocysteine-specific elongation factor OS=Homo sapiens GN=EEFSEC PE=1 SV=4 | 81 | 391 | 1.0E-15 |
sp|Q877P8|EFTU_XYLFT | Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 | 86 | 340 | 1.0E-15 |
sp|B9MQH1|EFTU_CALBD | Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|B9L7I8|EFTU_NAUPA | Elongation factor Tu OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q822I4|EFTU_CHLCV | Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 | 86 | 340 | 1.0E-15 |
sp|P51287|EFTU_PORPU | Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|A7MXE4|EFTU_VIBCB | Elongation factor Tu OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q7VJ74|EFTU_HELHP | Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 | 78 | 340 | 1.0E-15 |
sp|A4TS36|EFTU2_YERPP | Elongation factor Tu 2 OS=Yersinia pestis (strain Pestoides F) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q8ZAN8|EFTU2_YERPE | Elongation factor Tu-B OS=Yersinia pestis GN=tufB PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q1C1T4|EFTU2_YERPA | Elongation factor Tu 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q66FQ9|EFTU1_YERPS | Elongation factor Tu 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q1CN86|EFTU1_YERPN | Elongation factor Tu 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tuf1 PE=3 SV=2 | 86 | 340 | 1.0E-15 |
sp|A7FNJ0|EFTU1_YERP3 | Elongation factor Tu 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|A3DJ00|EFTU_CLOTH | Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 | 86 | 429 | 1.0E-15 |
sp|Q8R7V2|EFTU1_CALS4 | Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|A1WCN6|EFTU2_ACISJ | Elongation factor Tu 2 OS=Acidovorax sp. (strain JS42) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q30X13|EFTU_DESAG | Elongation factor Tu OS=Desulfovibrio alaskensis (strain G20) GN=tuf PE=3 SV=1 | 86 | 358 | 1.0E-15 |
sp|A8YUS2|EFTU_LACH4 | Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 | 86 | 371 | 1.0E-15 |
sp|B7GJ65|EFTU_ANOFW | Elongation factor Tu OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q3MDM5|EFTU_ANAVT | Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|P49410|EFTU_BOVIN | Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 | 86 | 429 | 1.0E-15 |
sp|Q8YP63|EFTU_NOSS1 | Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q5L3Z9|EFTU_GEOKA | Elongation factor Tu OS=Geobacillus kaustophilus (strain HTA426) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|Q9P9Q9|EFTU_XYLFA | Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 | 86 | 340 | 1.0E-15 |
sp|Q3IJV1|EFTU2_PSEHT | Elongation factor Tu 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-15 |
sp|C4K4F8|EFTU_HAMD5 | Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 | 82 | 358 | 1.0E-15 |
sp|Q3ILP4|EFTU1_PSEHT | Elongation factor Tu 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|P49411|EFTU_HUMAN | Elongation factor Tu, mitochondrial OS=Homo sapiens GN=TUFM PE=1 SV=2 | 86 | 340 | 2.0E-15 |
sp|Q057A2|EFTU_BUCCC | Elongation factor Tu OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|A7MKI5|EFTU_CROS8 | Elongation factor Tu OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tuf1 PE=3 SV=1 | 86 | 358 | 2.0E-15 |
sp|Q4L3K9|EFTU_STAHJ | Elongation factor Tu OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tuf PE=3 SV=1 | 87 | 429 | 2.0E-15 |
sp|Q7UZY7|EFTU_PROMP | Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|B2J5B1|EFTU_NOSP7 | Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|Q83ES6|EFTU_COXBU | Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 | 78 | 358 | 2.0E-15 |
sp|A9NAK7|EFTU_COXBR | Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 | 78 | 358 | 2.0E-15 |
sp|A9KD33|EFTU_COXBN | Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 | 78 | 358 | 2.0E-15 |
sp|A4IJI7|EFTU_GEOTN | Elongation factor Tu OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tuf PE=3 SV=1 | 86 | 371 | 2.0E-15 |
sp|A1W2Q5|EFTU1_ACISJ | Elongation factor Tu 1 OS=Acidovorax sp. (strain JS42) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|Q2YAZ9|EFTU_NITMU | Elongation factor Tu OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|A6VKH7|EFTU_ACTSZ | Elongation factor Tu OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|Q46IW4|EFTU_PROMT | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|A9WFP3|EFTU_CHLAA | Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|Q6LVC0|EFTU1_PHOPR | Elongation factor Tu 1 OS=Photobacterium profundum GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|Q8KAH0|EFTU_CHLTE | Elongation factor Tu OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|Q9ZEU3|EFTU_APPPP | Elongation factor Tu OS=Apple proliferation phytoplasma GN=tuf PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|A5N4N1|EFTU_CLOK5 | Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|A1WHC3|EFTU_VEREI | Elongation factor Tu OS=Verminephrobacter eiseniae (strain EF01-2) GN=tuf1 PE=3 SV=1 | 86 | 340 | 2.0E-15 |
sp|Q6LLV5|EFTU2_PHOPR | Elongation factor Tu 2 OS=Photobacterium profundum GN=tuf2 PE=3 SV=2 | 86 | 340 | 2.0E-15 |
sp|P42482|EFTU_WOLSU | Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 | 78 | 340 | 2.0E-15 |
sp|B9DKV8|EFTU_STACT | Elongation factor Tu OS=Staphylococcus carnosus (strain TM300) GN=tuf PE=3 SV=1 | 87 | 429 | 2.0E-15 |
sp|O21245|EFTU_RECAM | Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 | 87 | 378 | 2.0E-15 |
sp|Q605B0|EFTU_METCA | Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-15 |
sp|Q67JU1|EFTU_SYMTH | Elongation factor Tu OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-15 |
sp|B0JSE0|EFTU_MICAN | Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-15 |
sp|Q5FKR8|EFTU_LACAC | Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 | 86 | 371 | 3.0E-15 |
sp|Q6AP73|EFTU2_DESPS | Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 | 86 | 358 | 3.0E-15 |
sp|A4XI37|EFTU_CALS8 | Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-15 |
sp|Q8KT99|EFTU_RICHE | Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 | 86 | 358 | 3.0E-15 |
sp|A6TEX7|EFTU_KLEP7 | Elongation factor Tu OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tufA PE=3 SV=1 | 86 | 358 | 3.0E-15 |
sp|O33594|EFTU_STRAU | Elongation factor Tu OS=Streptomyces aureofaciens GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-15 |
sp|Q17VM8|EFTU_HELAH | Elongation factor Tu OS=Helicobacter acinonychis (strain Sheeba) GN=tuf PE=3 SV=1 | 86 | 340 | 3.0E-15 |
sp|Q73IX6|EFTU1_WOLPM | Elongation factor Tu 1 OS=Wolbachia pipientis wMel GN=tuf1 PE=3 SV=1 | 86 | 340 | 3.0E-15 |
sp|Q1BDD3|EFTU_MYCSS | Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|A1UBL1|EFTU_MYCSK | Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|A3PV96|EFTU_MYCSJ | Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|Q73H85|EFTU2_WOLPM | Elongation factor Tu 2 OS=Wolbachia pipientis wMel GN=tuf2 PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|Q65PA9|EFTU_BACLD | Elongation factor Tu OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tuf PE=3 SV=1 | 87 | 371 | 4.0E-15 |
sp|A5WH42|EFTU2_PSYWF | Elongation factor Tu 2 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf2 PE=3 SV=1 | 86 | 358 | 4.0E-15 |
sp|Q4ZMP2|EFTU_PSEU2 | Elongation factor Tu OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tuf PE=3 SV=1 | 86 | 358 | 4.0E-15 |
sp|A8EZL8|EFTU_RICCK | Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 | 86 | 358 | 4.0E-15 |
sp|A0KQ95|EFTU_AERHH | Elongation factor Tu OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tuf1 PE=3 SV=1 | 86 | 358 | 4.0E-15 |
sp|Q4QMW6|EFTU1_HAEI8 | Elongation factor Tu 1 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf1 PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|P13537|EFTU_THEMA | Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 | 86 | 340 | 4.0E-15 |
sp|A1JIH3|EFTU1_YERE8 | Elongation factor Tu 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tuf1 PE=3 SV=1 | 86 | 358 | 4.0E-15 |
sp|P0A1H5|EFTU_SALTY | Elongation factor Tu OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tufA PE=3 SV=2 | 86 | 340 | 4.0E-15 |
sp|P0A1H6|EFTU_SALTI | Elongation factor Tu OS=Salmonella typhi GN=tufA PE=3 SV=2 | 86 | 340 | 4.0E-15 |
sp|A9MT05|EFTU_SALPB | Elongation factor Tu OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tuf1 PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|Q5PIW4|EFTU_SALPA | Elongation factor Tu OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tuf1 PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|Q57H76|EFTU_SALCH | Elongation factor Tu OS=Salmonella choleraesuis (strain SC-B67) GN=tuf1 PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|A9MHG0|EFTU_SALAR | Elongation factor Tu OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tuf1 PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|Q8CQ81|EFTU_STAES | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tuf PE=3 SV=1 | 87 | 340 | 4.0E-15 |
sp|Q5HRK4|EFTU_STAEQ | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tuf PE=3 SV=1 | 87 | 340 | 4.0E-15 |
sp|A7ZUJ2|EFTU2_ECO24 | Elongation factor Tu 2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tuf2 PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|Q9KV37|EFTU1_VIBCH | Elongation factor Tu-A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tufA PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|B4S5M9|EFTU_PROA2 | Elongation factor Tu OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tuf PE=3 SV=1 | 86 | 340 | 4.0E-15 |
sp|O31298|EFTU_BUCAP | Elongation factor Tu OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tuf PE=3 SV=2 | 86 | 340 | 4.0E-15 |
sp|Q85FT7|EFTU_CYAME | Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1 | 86 | 429 | 4.0E-15 |
sp|B1LBP2|EFTU_THESQ | Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|A5IM81|EFTU_THEP1 | Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|B4SBU5|EFTU_PELPB | Elongation factor Tu OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|P30768|EFTU_MYCLE | Elongation factor Tu OS=Mycobacterium leprae (strain TN) GN=tuf PE=3 SV=2 | 86 | 340 | 5.0E-15 |
sp|B8ZSC1|EFTU_MYCLB | Elongation factor Tu OS=Mycobacterium leprae (strain Br4923) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|Q8KT97|EFTU_RICFE | Elongation factor Tu OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tuf PE=3 SV=1 | 86 | 358 | 5.0E-15 |
sp|Q7VA05|EFTU_PROMA | Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|Q03YI2|EFTU_LEUMM | Elongation factor Tu OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|P0A3B0|EFTU_RICSI | Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 | 86 | 358 | 5.0E-15 |
sp|P0A3A9|EFTU_RICRI | Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 | 86 | 358 | 5.0E-15 |
sp|Q5YPG4|EFTU_NOCFA | Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 | 86 | 340 | 5.0E-15 |
sp|A1T4L6|EFTU_MYCVP | Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|P42471|EFTU_BRELN | Elongation factor Tu OS=Brevibacterium linens GN=tuf PE=3 SV=1 | 86 | 363 | 5.0E-15 |
sp|B1KSM7|EFTU_CLOBM | Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|P50372|EFTU_CODFR | Elongation factor Tu, chloroplastic OS=Codium fragile GN=tufA PE=3 SV=1 | 86 | 340 | 5.0E-15 |
sp|A7GJ76|EFTU_CLOBL | Elongation factor Tu OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tuf1 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|B1IGF6|EFTU_CLOBK | Elongation factor Tu OS=Clostridium botulinum (strain Okra / Type B1) GN=tuf1 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|A5I7K8|EFTU_CLOBH | Elongation factor Tu OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tuf1 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|A7FZ71|EFTU_CLOB1 | Elongation factor Tu OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tuf1 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|P42479|EFTU_STIAU | Elongation factor Tu OS=Stigmatella aurantiaca GN=tuf PE=3 SV=2 | 86 | 340 | 6.0E-15 |
sp|A9NEN4|EFTU_ACHLI | Elongation factor Tu OS=Acholeplasma laidlawii (strain PG-8A) GN=tuf PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|A7GK18|EFTU_BACCN | Elongation factor Tu OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=tuf PE=3 SV=1 | 86 | 371 | 6.0E-15 |
sp|A8GT71|EFTU_RICRS | Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 | 86 | 358 | 6.0E-15 |
sp|B0BUR2|EFTU_RICRO | Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 | 86 | 358 | 6.0E-15 |
sp|C4K2I2|EFTU_RICPU | Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 | 86 | 358 | 6.0E-15 |
sp|C3PPA9|EFTU_RICAE | Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 | 86 | 358 | 6.0E-15 |
sp|P43926|EFTU_HAEIN | Elongation factor Tu OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tufA PE=3 SV=2 | 86 | 340 | 6.0E-15 |
sp|A5UHC1|EFTU_HAEIG | Elongation factor Tu OS=Haemophilus influenzae (strain PittGG) GN=tuf PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|A5U9R1|EFTU_HAEIE | Elongation factor Tu OS=Haemophilus influenzae (strain PittEE) GN=tuf1 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|Q4QMT5|EFTU2_HAEI8 | Elongation factor Tu 2 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|Q92GW4|EFTU_RICCN | Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 | 86 | 358 | 6.0E-15 |
sp|Q0SZX8|EFTU1_SHIF8 | Elongation factor Tu 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=tuf1 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|Q6CZW6|EFTU_PECAS | Elongation factor Tu OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tuf1 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|P0A6N2|EFTU_ECOL6 | Elongation factor Tu OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tufA PE=3 SV=2 | 86 | 340 | 6.0E-15 |
sp|P0A6N3|EFTU_ECO57 | Elongation factor Tu OS=Escherichia coli O157:H7 GN=tufA PE=3 SV=2 | 86 | 340 | 6.0E-15 |
sp|Q3YV04|EFTU2_SHISS | Elongation factor Tu 2 OS=Shigella sonnei (strain Ss046) GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|Q0SY20|EFTU2_SHIF8 | Elongation factor Tu 2 OS=Shigella flexneri serotype 5b (strain 8401) GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|Q1R5U4|EFTU2_ECOUT | Elongation factor Tu 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=tuf2 PE=3 SV=2 | 86 | 340 | 6.0E-15 |
sp|P0CE48|EFTU2_ECOLI | Elongation factor Tu 2 OS=Escherichia coli (strain K12) GN=tufB PE=1 SV=1 | 86 | 340 | 6.0E-15 |
sp|B1IVA7|EFTU2_ECOLC | Elongation factor Tu 2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|Q0TA85|EFTU2_ECOL5 | Elongation factor Tu 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|A1AIF3|EFTU2_ECOK1 | Elongation factor Tu 2 OS=Escherichia coli O1:K1 / APEC GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|A8A779|EFTU2_ECOHS | Elongation factor Tu 2 OS=Escherichia coli O9:H4 (strain HS) GN=tuf2 PE=3 SV=1 | 86 | 340 | 6.0E-15 |
sp|B3EP63|EFTU_CHLPB | Elongation factor Tu OS=Chlorobium phaeobacteroides (strain BS1) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|A6GYU7|EFTU_FLAPJ | Elongation factor Tu OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|Q83JC4|EFTU_SHIFL | Elongation factor Tu OS=Shigella flexneri GN=tufA PE=3 SV=3 | 86 | 340 | 7.0E-15 |
sp|Q32B27|EFTU_SHIDS | Elongation factor Tu OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|Q31VV0|EFTU_SHIBS | Elongation factor Tu OS=Shigella boydii serotype 4 (strain Sb227) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|Q3YWT3|EFTU1_SHISS | Elongation factor Tu 1 OS=Shigella sonnei (strain Ss046) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|Q1R5Y2|EFTU1_ECOUT | Elongation factor Tu 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=tuf1 PE=1 SV=1 | 86 | 340 | 7.0E-15 |
sp|P0CE47|EFTU1_ECOLI | Elongation factor Tu 1 OS=Escherichia coli (strain K12) GN=tufA PE=1 SV=1 | 86 | 340 | 7.0E-15 |
sp|B1IPW0|EFTU1_ECOLC | Elongation factor Tu 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|Q0TCC0|EFTU1_ECOL5 | Elongation factor Tu 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|A1AGM6|EFTU1_ECOK1 | Elongation factor Tu 1 OS=Escherichia coli O1:K1 / APEC GN=tuf1 PE=3 SV=2 | 86 | 340 | 7.0E-15 |
sp|A8A5E6|EFTU1_ECOHS | Elongation factor Tu 1 OS=Escherichia coli O9:H4 (strain HS) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|A7ZSL4|EFTU1_ECO24 | Elongation factor Tu 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tuf1 PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|A8F4Q9|EFTU_PSELT | Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|B9K884|EFTU_THENN | Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 | 86 | 340 | 7.0E-15 |
sp|Q9TJQ8|EFTU_PROWI | Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 | 82 | 340 | 7.0E-15 |
sp|P13927|EFTU_MYCGE | Elongation factor Tu OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-15 |
sp|O50306|EFTU_GEOSE | Elongation factor Tu OS=Geobacillus stearothermophilus GN=tuf PE=3 SV=2 | 86 | 340 | 8.0E-15 |
sp|P59506|EFTU_BUCBP | Elongation factor Tu OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-15 |
sp|A5WGK9|EFTU1_PSYWF | Elongation factor Tu 1 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf1 PE=3 SV=1 | 86 | 358 | 8.0E-15 |
sp|A6Q6H4|EFTU_SULNB | Elongation factor Tu OS=Sulfurovum sp. (strain NBC37-1) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-15 |
sp|A0M3Z6|EFTU_GRAFK | Elongation factor Tu OS=Gramella forsetii (strain KT0803) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-15 |
sp|A6LPP6|EFTU_CLOB8 | Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 | 86 | 340 | 8.0E-15 |
sp|A1BJ36|EFTU_CHLPD | Elongation factor Tu OS=Chlorobium phaeobacteroides (strain DSM 266) GN=tuf PE=3 SV=1 | 86 | 340 | 8.0E-15 |
sp|A1TYJ5|EFTU_MARHV | Elongation factor Tu OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tuf PE=3 SV=1 | 86 | 358 | 8.0E-15 |
sp|A4SHU2|EFTU_AERS4 | Elongation factor Tu OS=Aeromonas salmonicida (strain A449) GN=tuf1 PE=3 SV=1 | 86 | 358 | 9.0E-15 |
sp|Q5NID9|EFTU_FRATT | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tuf PE=3 SV=1 | 86 | 342 | 9.0E-15 |
sp|Q14JU2|EFTU_FRAT1 | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tuf PE=3 SV=1 | 86 | 342 | 9.0E-15 |
sp|Q31IY4|EFTU_THICR | Elongation factor Tu OS=Thiomicrospira crunogena (strain XCL-2) GN=tuf1 PE=3 SV=1 | 86 | 340 | 9.0E-15 |
sp|A4WVL0|EFTU_RHOS5 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tuf1 PE=3 SV=1 | 86 | 340 | 9.0E-15 |
sp|B0UV21|EFTU_HISS2 | Elongation factor Tu OS=Histophilus somni (strain 2336) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|Q0I1U9|EFTU_HAES1 | Elongation factor Tu OS=Haemophilus somnus (strain 129Pt) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|P23568|EFTU_MYCPN | Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tuf PE=3 SV=2 | 86 | 340 | 1.0E-14 |
sp|A4W5A0|EFTU_ENT38 | Elongation factor Tu OS=Enterobacter sp. (strain 638) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|B0TX03|EFTU_FRAP2 | Elongation factor Tu OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tuf PE=3 SV=1 | 86 | 342 | 1.0E-14 |
sp|A4IW92|EFTU_FRATW | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tuf PE=3 SV=1 | 86 | 342 | 1.0E-14 |
sp|Q0BKB8|EFTU_FRATO | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tuf PE=3 SV=1 | 86 | 342 | 1.0E-14 |
sp|A0Q874|EFTU_FRATN | Elongation factor Tu OS=Francisella tularensis subsp. novicida (strain U112) GN=tuf PE=3 SV=1 | 86 | 342 | 1.0E-14 |
sp|B2SFC9|EFTU_FRATM | Elongation factor Tu OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tuf PE=3 SV=1 | 86 | 342 | 1.0E-14 |
sp|Q2A1M0|EFTU_FRATH | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tuf PE=3 SV=1 | 86 | 342 | 1.0E-14 |
sp|A7NEC7|EFTU_FRATF | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tuf PE=3 SV=1 | 86 | 342 | 1.0E-14 |
sp|A8Z5T8|EFTU_SULMW | Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 | 75 | 340 | 1.0E-14 |
sp|A8GPF2|EFTU_RICAH | Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|A1AX82|EFTU2_RUTMC | Elongation factor Tu 2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf2 PE=3 SV=1 | 86 | 371 | 1.0E-14 |
sp|Q99QM0|EFTU_CAUCR | Elongation factor Tu OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tufA PE=3 SV=1 | 87 | 340 | 1.0E-14 |
sp|P43927|SELB_HAEIN | Selenocysteine-specific elongation factor OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=selB PE=3 SV=1 | 88 | 343 | 1.0E-14 |
sp|P48865|EFTU_RICPR | Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 | 86 | 340 | 1.0E-14 |
sp|P26184|EFTU_FLESI | Elongation factor Tu OS=Flexistipes sinusarabici GN=tuf PE=3 SV=1 | 82 | 340 | 1.0E-14 |
sp|Q8KT95|EFTU_RICTY | Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 | 86 | 340 | 1.0E-14 |
sp|B0TC54|EFTU_HELMI | Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|Q664R7|EFTU2_YERPS | Elongation factor Tu 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|Q1CCT9|EFTU2_YERPN | Elongation factor Tu 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|A7FNN8|EFTU2_YERP3 | Elongation factor Tu 2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tuf2 PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|A4TGY7|EFTU1_YERPP | Elongation factor Tu 1 OS=Yersinia pestis (strain Pestoides F) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|Q8ZJB2|EFTU1_YERPE | Elongation factor Tu-A OS=Yersinia pestis GN=tufA PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|Q1C2U1|EFTU1_YERPA | Elongation factor Tu 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tuf1 PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|B8DLL9|EFTU_DESVM | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 | 82 | 340 | 1.0E-14 |
sp|P14081|SELB_ECOLI | Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) GN=selB PE=1 SV=3 | 88 | 340 | 1.0E-14 |
sp|A4T1R2|EFTU_MYCGI | Elongation factor Tu OS=Mycobacterium gilvum (strain PYR-GCK) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|Q9TLV8|EFTU_CYACA | Elongation factor Tu, chloroplastic OS=Cyanidium caldarium GN=tufA PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|Q47LJ1|EFTU_THEFY | Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|P42478|EFTU_SPIAU | Elongation factor Tu (Fragment) OS=Spirochaeta aurantia GN=tuf PE=3 SV=1 | 86 | 340 | 1.0E-14 |
sp|P74227|EFTU_SYNY3 | Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tuf PE=1 SV=1 | 86 | 340 | 1.0E-14 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003924 | GTPase activity | Yes |
GO:0005525 | GTP binding | Yes |
GO:1901265 | nucleoside phosphate binding | No |
GO:0016787 | hydrolase activity | No |
GO:0032555 | purine ribonucleotide binding | No |
GO:0005488 | binding | No |
GO:0003824 | catalytic activity | No |
GO:0036094 | small molecule binding | No |
GO:0017111 | nucleoside-triphosphatase activity | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0016462 | pyrophosphatase activity | No |
GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
GO:0035639 | purine ribonucleoside triphosphate binding | No |
GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
GO:0043167 | ion binding | No |
GO:0019001 | guanyl nucleotide binding | No |
GO:0000166 | nucleotide binding | No |
GO:0043168 | anion binding | No |
GO:0032553 | ribonucleotide binding | No |
GO:0003674 | molecular_function | No |
GO:0032561 | guanyl ribonucleotide binding | No |
GO:0097367 | carbohydrate derivative binding | No |
GO:0017076 | purine nucleotide binding | No |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Cytoplasm | Nuclear localization signal | 0.6015 | 0.4698 | 0.014 | 0.0583 | 0.1135 | 0.0574 | 0.1682 | 0.0434 | 0.1685 | 0.0029 |
Orthofinder run ID | 4 |
Orthogroup | 1941 |
Change Orthofinder run |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|2079 MSANGDPKYDDLESESDSGDSFDGQHDAADAIDDKALKPALKKSNPAIPDQTVERPPLPPQTDPKDLDVASLTPL TPEIIARQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELIRNITIKLGYANAKIYKCDNPECPRPGCYRSYK SEKEVDPPCEREACGGTYRLLRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMK LDKIIILQNKVDLMREEAAQQHYESILKFIRGTVAGKSPVIPISAQLKFNIDAVNEAIVNTIPVPPRDFTMDPHM IVIRSFDVNKPGAEIDELKGGVAGGSILHGVVKLGDEIEIRPGIVSRDDSGALKCTPIFSRVVSLNSEANDLKYA VPGGLIGVGTRIDPTLCRADRLVGFVLGLRGRLPEIYSEIEVNFYLLRRLLGVRTADGKQAKVAKLAKNEVIMVN IGSTSTGAKVAAIKNDAAKLVLTSPACTNIGEKVALSRRIEKHWRLIGWATIAAGVTLEPSTS* |
Coding | >Hirsu2|2079 ATGTCTGCCAACGGCGACCCCAAATACGACGACCTCGAGTCCGAGTCCGACTCGGGCGACTCCTTCGATGGCCAG CACGACGCCGCCGACGCCATCGACGACAAGGCCCTCAAGCCGGCCCTCAAAAAGTCCAATCCCGCCATCCCAGAC CAGACGGTTGAGCGGCCCCCGCTGCCCCCGCAGACGGACCCCAAAGATCTCGACGTCGCCAGCCTGACGCCCCTC ACCCCCGAGATCATTGCGCGCCAAGCGACCATCAACATCGGCACCATCGGCCACGTCGCCCACGGCAAGTCCACC GTCGTCAAGGCCATCTCGGGCGTCCAGACCGTCCGCTTCAAGAACGAGCTGATCCGCAACATCACCATCAAGCTG GGCTATGCCAACGCCAAGATCTACAAGTGCGACAATCCCGAATGTCCACGCCCCGGTTGCTACCGGAGCTACAAG AGCGAGAAGGAGGTCGACCCGCCCTGCGAGAGAGAGGCCTGCGGCGGCACCTACAGGCTGTTGCGCCACGTCTCC TTCGTCGACTGCCCGGGCCACGACATTCTCATGAGCACCATGCTGTCGGGCGCTGCCGTCATGGACGCGGCGCTC CTCCTCATCGCCGGCAATGAATCCTGTCCCCAGCCCCAGACCTCGGAGCATTTGGCCGCCATCGAGATCATGAAG CTGGACAAGATCATCATCCTGCAGAACAAGGTCGACCTGATGAGGGAAGAGGCCGCCCAGCAGCACTACGAGTCC ATTCTCAAATTCATCCGCGGAACGGTCGCCGGCAAGTCTCCCGTCATCCCCATCTCCGCCCAGCTCAAGTTCAAC ATCGACGCCGTCAACGAGGCCATTGTCAACACCATCCCCGTCCCCCCCCGGGACTTCACCATGGACCCCCACATG ATCGTCATCCGCTCCTTCGACGTCAACAAGCCCGGCGCCGAGATCGACGAGCTGAAGGGTGGCGTTGCCGGCGGC AGCATCCTGCACGGCGTCGTCAAGCTCGGCGACGAGATTGAGATCCGGCCCGGCATCGTGTCTCGAGACGACAGC GGCGCCCTCAAGTGCACCCCCATCTTCAGCAGGGTCGTCTCCCTCAACTCCGAGGCCAACGACCTCAAGTACGCC GTCCCCGGCGGCCTGATTGGTGTCGGCACGCGCATCGACCCCACCCTCTGCCGAGCCGACCGTCTCGTCGGCTTC GTCCTCGGCCTCCGCGGCAGGCTGCCCGAGATCTACAGCGAGATCGAGGTCAACTTCTACCTGCTCCGCCGCCTG CTCGGCGTGCGGACCGCCGACGGGAAGCAGGCCAAGGTCGCCAAGCTGGCCAAGAACGAGGTCATCATGGTCAAC ATCGGCTCCACCTCGACCGGCGCCAAGGTCGCCGCCATCAAGAACGATGCCGCCAAGCTGGTCCTGACCAGCCCC GCCTGCACAAACATTGGCGAGAAGGTCGCGCTGAGTCGGCGTATCGAGAAGCACTGGCGTCTCATCGGTTGGGCT ACCATCGCAGCCGGTGTTACGTTGGAGCCCAGCACGTCTTGA |
Transcript | >Hirsu2|2079 ATGTCTGCCAACGGCGACCCCAAATACGACGACCTCGAGTCCGAGTCCGACTCGGGCGACTCCTTCGATGGCCAG CACGACGCCGCCGACGCCATCGACGACAAGGCCCTCAAGCCGGCCCTCAAAAAGTCCAATCCCGCCATCCCAGAC CAGACGGTTGAGCGGCCCCCGCTGCCCCCGCAGACGGACCCCAAAGATCTCGACGTCGCCAGCCTGACGCCCCTC ACCCCCGAGATCATTGCGCGCCAAGCGACCATCAACATCGGCACCATCGGCCACGTCGCCCACGGCAAGTCCACC GTCGTCAAGGCCATCTCGGGCGTCCAGACCGTCCGCTTCAAGAACGAGCTGATCCGCAACATCACCATCAAGCTG GGCTATGCCAACGCCAAGATCTACAAGTGCGACAATCCCGAATGTCCACGCCCCGGTTGCTACCGGAGCTACAAG AGCGAGAAGGAGGTCGACCCGCCCTGCGAGAGAGAGGCCTGCGGCGGCACCTACAGGCTGTTGCGCCACGTCTCC TTCGTCGACTGCCCGGGCCACGACATTCTCATGAGCACCATGCTGTCGGGCGCTGCCGTCATGGACGCGGCGCTC CTCCTCATCGCCGGCAATGAATCCTGTCCCCAGCCCCAGACCTCGGAGCATTTGGCCGCCATCGAGATCATGAAG CTGGACAAGATCATCATCCTGCAGAACAAGGTCGACCTGATGAGGGAAGAGGCCGCCCAGCAGCACTACGAGTCC ATTCTCAAATTCATCCGCGGAACGGTCGCCGGCAAGTCTCCCGTCATCCCCATCTCCGCCCAGCTCAAGTTCAAC ATCGACGCCGTCAACGAGGCCATTGTCAACACCATCCCCGTCCCCCCCCGGGACTTCACCATGGACCCCCACATG ATCGTCATCCGCTCCTTCGACGTCAACAAGCCCGGCGCCGAGATCGACGAGCTGAAGGGTGGCGTTGCCGGCGGC AGCATCCTGCACGGCGTCGTCAAGCTCGGCGACGAGATTGAGATCCGGCCCGGCATCGTGTCTCGAGACGACAGC GGCGCCCTCAAGTGCACCCCCATCTTCAGCAGGGTCGTCTCCCTCAACTCCGAGGCCAACGACCTCAAGTACGCC GTCCCCGGCGGCCTGATTGGTGTCGGCACGCGCATCGACCCCACCCTCTGCCGAGCCGACCGTCTCGTCGGCTTC GTCCTCGGCCTCCGCGGCAGGCTGCCCGAGATCTACAGCGAGATCGAGGTCAACTTCTACCTGCTCCGCCGCCTG CTCGGCGTGCGGACCGCCGACGGGAAGCAGGCCAAGGTCGCCAAGCTGGCCAAGAACGAGGTCATCATGGTCAAC ATCGGCTCCACCTCGACCGGCGCCAAGGTCGCCGCCATCAAGAACGATGCCGCCAAGCTGGTCCTGACCAGCCCC GCCTGCACAAACATTGGCGAGAAGGTCGCGCTGAGTCGGCGTATCGAGAAGCACTGGCGTCTCATCGGTTGGGCT ACCATCGCAGCCGGTGTTACGTTGGAGCCCAGCACGTCTTGA |
Gene | >Hirsu2|2079 ATGTCTGCCAACGGCGACCCCAAATACGACGACCTCGAGTCCGAGTCCGACTCGGGCGACTCCTTCGATGGCCAG CACGACGCCGCCGACGCCATCGACGACAAGGCCCTCAAGCCGGCCCTCAAAAAGTCCAATCCCGCCATCCCAGAC CAGACGGTTGAGCGGCCCCCGCTGCCCCCGCAGACGGACCCCAAAGATCTCGACGTCGCCAGCCTGACGCCCCTC ACCCCCGAGATCATTGCGCGCCAAGCGACCATCAACATCGGCACCATCGGCCACGTCGCCCACGGCAAGTCCACC GTCGTCAAGGCCATCTCGGGCGTCCAGACCGTCCGCTTCAAGAACGAGCTGATCCGCAACATCACCATCAAGCTG GGCTATGCCAACGCCAAGATCTACAAGTGCGACAATCCCGAATGTCCACGCCCCGGTTGCTACCGGAGCTACAAG AGCGAGAAGGAGGTCGACCCGCCCTGCGAGAGAGAGGCCTGCGGCGGCACCTACAGGCTGTTGCGCCACGTCTCG TAAGTTCTCCCTTTCGTCTCCCGACGATCGAGCTGACTCCGCCGCTCGCCCCAGCTTCGTCGACTGCCCGGGCCA CGACATTCTCATGAGCACCATGCTGTCGGGCGCTGCCGTCATGGACGCGGCGCTCCTCCTCATCGCCGGCAATGA ATCCTGTCCCCAGCCCCAGACCTCGGAGCATTTGGCCGCCATCGAGATCATGAAGCTGGACAAGATCATCATCCT GCAGAACAAGGTCGACCTGATGAGGGAAGAGGCCGCCCAGCAGCACTACGAGTCCATTCTCAAATTCATCCGCGG AACGGTCGCCGGCAAGTCTCCCGTCATCCCCATCTCCGCCCAGCTCAAGTTCAACATCGACGCCGTCAACGAGGC CATTGTCAACACCATCCCCGTCCCCCCCCGGGACTTCACCATGGACCCCCACATGATCGTCATCCGCTCCTTCGA CGTCAACAAGCCCGGCGCCGAGATCGACGAGCTGAAGGGTGGCGTTGCCGGCGGCAGCATCCTGCACGGCGTCGT CAAGCTCGGCGACGAGATTGAGATCCGGCCCGGCATCGTGTCTCGAGACGACAGCGGCGCCCTCAAGTGCACCCC CATCTTCAGCAGGGTCGTCTCCCTCAACTCCGAGGCCAACGACCTCAAGTACGCCGTCCCCGGCGGCCTGATTGG TGTCGGCACGCGCATCGACCCCACCCTCTGCCGAGCCGACCGTCTCGTCGGCTTCGTCCTCGGCCTCCGCGGCAG GCTGCCCGAGATCTACAGCGAGATCGAGGTCAACTTCTACCTGCTCCGCCGCCTGCTCGGCGTGCGGACCGCCGA CGGGAAGCAGGCCAAGGTCGCCAAGCTGGCCAAGAACGAGGTCATCATGGTCAACATCGGCTCCACCTCGACCGG CGCCAAGGTCGCCGCCATCAAGAACGATGCCGCCAAGCTGGTCCTGACCAGCCCCGCCTGCACAAACATTGGCGA GAAGGTCGCGCTGAGTCGGCGTATCGAGAAGCACTGGCGTCTCATCGGTTGGGCTACCATCGCAGCGTGAGTTGC CCCCTCGTCCCCCTCGTCTTTCCCCTCAACCCTGTCACGCACCCCATCGCCTCGTCCTCGACCGACTGACCGGCC CTTCTTTTAGCGGTGTTACGTTGGAGCCCAGCACGTCTTGA |