Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2063
Gene name
LocationContig_148:32860..33664
Strand+
Gene length (bp)804
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05773 RWD RWD domain 3.2E-22 4 121
PF16543 DFRP_C DRG Family Regulatory Proteins, Tma46 5.4E-08 139 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H446|RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens GN=RWDD1 PE=1 SV=1 4 206 8.0E-22
sp|Q99ND9|RWDD1_RAT RWD domain-containing protein 1 OS=Rattus norvegicus GN=Rwdd1 PE=2 SV=1 4 206 1.0E-21
sp|Q9CQK7|RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus GN=Rwdd1 PE=1 SV=1 4 206 3.0E-21
sp|Q03768|GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIR2 PE=1 SV=1 3 235 5.0E-21
sp|O94721|YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.09c PE=3 SV=1 8 214 8.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H446|RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens GN=RWDD1 PE=1 SV=1 4 206 8.0E-22
sp|Q99ND9|RWDD1_RAT RWD domain-containing protein 1 OS=Rattus norvegicus GN=Rwdd1 PE=2 SV=1 4 206 1.0E-21
sp|Q9CQK7|RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus GN=Rwdd1 PE=1 SV=1 4 206 3.0E-21
sp|Q03768|GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIR2 PE=1 SV=1 3 235 5.0E-21
sp|O94721|YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.09c PE=3 SV=1 8 214 8.0E-20
sp|Q9CPR1|RWDD4_MOUSE RWD domain-containing protein 4 OS=Mus musculus GN=Rwdd4 PE=2 SV=1 3 145 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2063
MPREEQVEEREVLESIFPDEITDISETEFRISVTLDVPADESGEAEAEAEPPGFLLHVRYPDDYPDAAPHLDMLA
APNAAPRADFSVAEDRAQLLAGLEATVRENLGMAMVFTLVTALREAAEQLIQARHDAATAARDEALLAAERAENA
KFHGTPVTPDSFLRWRRDFLREMDEAERREEEERAAELRRARVKDPVRLTGKQLWERGLAGRGDDDDADDDDAAV
PTEGLERLQVEAA*
Coding >Hirsu2|2063
ATGCCGCGCGAGGAACAGGTGGAAGAGCGCGAGGTGCTCGAGTCCATCTTCCCGGACGAAATCACCGACATCTCC
GAGACCGAGTTCAGGATATCCGTCACGCTGGACGTGCCCGCCGACGAGTCGGGCGAGGCCGAGGCCGAGGCCGAG
CCGCCGGGCTTCCTGCTGCACGTGCGCTACCCGGACGACTACCCGGACGCGGCGCCGCACCTGGACATGCTGGCG
GCGCCCAACGCGGCGCCGCGGGCCGACTTCAGCGTGGCCGAGGACCGGGCGCAGCTGCTGGCCGGGCTGGAGGCG
ACGGTGCGCGAGAACCTGGGCATGGCCATGGTCTTCACCCTCGTCACGGCGCTGCGCGAGGCGGCCGAGCAGCTG
ATACAGGCGCGGCACGACGCCGCCACCGCGGCCCGCGACGAGGCCCTGCTGGCGGCCGAGCGGGCCGAGAACGCA
AAGTTCCACGGCACGCCCGTCACGCCCGACTCCTTCCTGCGCTGGCGCCGCGACTTTTTGCGCGAGATGGACGAG
GCCGAGCGCCGCGAGGAGGAGGAGCGCGCGGCCGAGCTGCGCCGCGCCCGCGTCAAGGACCCCGTCCGCCTCACC
GGCAAGCAGCTCTGGGAGCGCGGCCTGGCCGGCAGGGGCGACGACGACGACGCCGACGACGACGACGCCGCCGTG
CCGACCGAAGGCCTCGAGAGGCTGCAGGTCGAGGCCGCCTGA
Transcript >Hirsu2|2063
ATGCCGCGCGAGGAACAGGTGGAAGAGCGCGAGGTGCTCGAGTCCATCTTCCCGGACGAAATCACCGACATCTCC
GAGACCGAGTTCAGGATATCCGTCACGCTGGACGTGCCCGCCGACGAGTCGGGCGAGGCCGAGGCCGAGGCCGAG
CCGCCGGGCTTCCTGCTGCACGTGCGCTACCCGGACGACTACCCGGACGCGGCGCCGCACCTGGACATGCTGGCG
GCGCCCAACGCGGCGCCGCGGGCCGACTTCAGCGTGGCCGAGGACCGGGCGCAGCTGCTGGCCGGGCTGGAGGCG
ACGGTGCGCGAGAACCTGGGCATGGCCATGGTCTTCACCCTCGTCACGGCGCTGCGCGAGGCGGCCGAGCAGCTG
ATACAGGCGCGGCACGACGCCGCCACCGCGGCCCGCGACGAGGCCCTGCTGGCGGCCGAGCGGGCCGAGAACGCA
AAGTTCCACGGCACGCCCGTCACGCCCGACTCCTTCCTGCGCTGGCGCCGCGACTTTTTGCGCGAGATGGACGAG
GCCGAGCGCCGCGAGGAGGAGGAGCGCGCGGCCGAGCTGCGCCGCGCCCGCGTCAAGGACCCCGTCCGCCTCACC
GGCAAGCAGCTCTGGGAGCGCGGCCTGGCCGGCAGGGGCGACGACGACGACGCCGACGACGACGACGCCGCCGTG
CCGACCGAAGGCCTCGAGAGGCTGCAGGTCGAGGCCGCCTGA
Gene >Hirsu2|2063
ATGCCGCGCGAGGAACAGGTGGAAGAGCGCGAGGTGCTCGAGTCCATCTTCCCGGACGAAATCACCGGTGCGCCC
GTCCGTCCCAGAGAGCTTGAAAAAGAAGAGAAGAGAAAGGAGAGAAAAAAAACATTAACCCGACTCATGCGGTGA
GCAGACATCTCCGAGACCGAGTTCAGGATATCCGTCACGCTGGACGTGCCCGCCGACGAGTCGGGCGAGGCCGAG
GCCGAGGCCGAGCCGCCGGGCTTCCTGCTGCACGTGCGCTACCCGGACGACTACCCGGACGCGGCGCCGCACCTG
GACATGCTGGCGGCGCCCAACGCGGCGCCGCGGGCCGACTTCAGCGTGGCCGAGGACCGGGCGCAGCTGCTGGCC
GGGCTGGAGGCGACGGTGCGCGAGAACCTGGGCATGGCCATGGTCTTCACCCTCGTCACGGCGCTGCGCGAGGCG
GCCGAGCAGCTGATACAGGCGCGGCACGACGCCGCCACCGCGGCCCGCGACGAGGCCCTGCTGGCGGCCGAGCGG
GCCGAGAACGCAAAGTTCCACGGCACGCCCGTCACGCCCGACTCCTTCCTGCGCTGGCGCCGCGACTTTTTGCGC
GAGATGGACGAGGCCGAGCGCCGCGAGGAGGAGGAGCGCGCGGCCGAGCTGCGCCGCGCCCGCGTCAAGGACCCC
GTCCGCCTCACCGGCAAGCAGCTCTGGGAGCGCGGCCTGGCCGGCAGGGGCGACGACGACGACGCCGACGACGAC
GACGCCGCCGTGCCGACCGAAGGCCTCGAGAGGCTGCAGGTCGAGGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail