Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2055
Gene name
LocationContig_148:20756..21687
Strand+
Gene length (bp)931
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01253 SUI1 Translation initiation factor SUI1 2.5E-24 100 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4QVI3|DENR_MAGO7 Translation machinery-associated protein 22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TMA22 PE=3 SV=2 1 200 2.0E-99
sp|Q2H5Z7|DENR_CHAGB Translation machinery-associated protein 22 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TMA22 PE=3 SV=1 13 195 9.0E-91
sp|Q9P3T4|DENR_NEUCR Translation machinery-associated protein 22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tma-22 PE=3 SV=1 15 187 5.0E-90
sp|A6SIZ0|DENR_BOTFB Translation machinery-associated protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=tma22 PE=3 SV=1 1 191 2.0E-83
sp|A2QHG9|DENR_ASPNC Translation machinery-associated protein 22 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tma22 PE=3 SV=1 1 196 1.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4QVI3|DENR_MAGO7 Translation machinery-associated protein 22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TMA22 PE=3 SV=2 1 200 2.0E-99
sp|Q2H5Z7|DENR_CHAGB Translation machinery-associated protein 22 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TMA22 PE=3 SV=1 13 195 9.0E-91
sp|Q9P3T4|DENR_NEUCR Translation machinery-associated protein 22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tma-22 PE=3 SV=1 15 187 5.0E-90
sp|A6SIZ0|DENR_BOTFB Translation machinery-associated protein 22 OS=Botryotinia fuckeliana (strain B05.10) GN=tma22 PE=3 SV=1 1 191 2.0E-83
sp|A2QHG9|DENR_ASPNC Translation machinery-associated protein 22 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tma22 PE=3 SV=1 1 196 1.0E-73
sp|Q2TVZ2|DENR_ASPOR Translation machinery-associated protein 22 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tma22 PE=3 SV=1 1 194 8.0E-72
sp|Q1E556|DENR_COCIM Translation machinery-associated protein 22 OS=Coccidioides immitis (strain RS) GN=TMA22 PE=3 SV=1 2 187 2.0E-70
sp|A1DAY1|DENR_NEOFI Translation machinery-associated protein 22 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tma22 PE=3 SV=1 1 191 2.0E-69
sp|A1C8E3|DENR_ASPCL Translation machinery-associated protein 22 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tma22 PE=3 SV=1 1 194 4.0E-69
sp|Q4WBL6|DENR_ASPFU Translation machinery-associated protein 22 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tma22 PE=3 SV=2 1 194 8.0E-69
sp|O42929|DENR_SCHPO Translation machinery-associated protein 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tma22 PE=3 SV=1 13 192 2.0E-52
sp|A3LSY0|DENR_PICST Translation machinery-associated protein 22 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TMA22 PE=3 SV=1 15 192 2.0E-52
sp|A5DGV3|DENR_PICGU Translation machinery-associated protein 22 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TMA22 PE=3 SV=1 11 187 2.0E-52
sp|Q6BH22|DENR_DEBHA Translation machinery-associated protein 22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TMA22 PE=3 SV=1 16 187 2.0E-51
sp|Q6CA08|DENR_YARLI Translation machinery-associated protein 22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TMA22 PE=3 SV=1 16 192 7.0E-50
sp|A7TES6|DENR_VANPO Translation machinery-associated protein 22 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TMA22 PE=3 SV=1 16 192 2.0E-38
sp|Q6FXQ4|DENR_CANGA Translation machinery-associated protein 22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TMA22 PE=3 SV=1 16 199 2.0E-38
sp|P0CR80|DENR_CRYNJ Translation machinery-associated protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TMA22 PE=3 SV=1 17 182 6.0E-38
sp|P0CR81|DENR_CRYNB Translation machinery-associated protein 22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TMA22 PE=3 SV=1 17 182 6.0E-38
sp|P47089|DENR_YEAST Translation machinery-associated protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA22 PE=1 SV=1 16 170 8.0E-38
sp|A6ZPY2|DENR_YEAS7 Translation machinery-associated protein 22 OS=Saccharomyces cerevisiae (strain YJM789) GN=TMA22 PE=3 SV=1 16 170 8.0E-38
sp|A5E3R9|DENR_LODEL Translation machinery-associated protein 22 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TMA22 PE=3 SV=1 16 176 3.0E-35
sp|Q6CJ30|DENR_KLULA Translation machinery-associated protein 22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TMA22 PE=3 SV=1 17 186 4.0E-35
sp|Q75CN1|DENR_ASHGO Translation machinery-associated protein 22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TMA22 PE=3 SV=1 18 170 3.0E-33
sp|Q6GLZ1|DENR_XENLA Density-regulated protein OS=Xenopus laevis GN=denr PE=2 SV=1 18 190 6.0E-30
sp|Q6DFN7|DENR_XENTR Density-regulated protein OS=Xenopus tropicalis GN=denr PE=2 SV=1 18 190 3.0E-29
sp|O43583|DENR_HUMAN Density-regulated protein OS=Homo sapiens GN=DENR PE=1 SV=2 17 190 4.0E-29
sp|Q2HJ47|DENR_BOVIN Density-regulated protein OS=Bos taurus GN=DENR PE=2 SV=1 17 190 6.0E-29
sp|Q5RFP5|DENR_PONAB Density-regulated protein OS=Pongo abelii GN=DENR PE=2 SV=1 17 190 8.0E-29
sp|Q9CQJ6|DENR_MOUSE Density-regulated protein OS=Mus musculus GN=Denr PE=1 SV=1 17 190 2.0E-28
sp|Q5ZJ39|DENR_CHICK Density-regulated protein OS=Gallus gallus GN=DENR PE=2 SV=1 17 190 3.0E-28
sp|Q6DH65|DENR_DANRE Density-regulated protein OS=Danio rerio GN=denr PE=1 SV=1 11 190 1.0E-25
sp|Q9VX98|DENR_DROME Density-regulated protein homolog OS=Drosophila melanogaster GN=DENR PE=1 SV=3 20 190 4.0E-23
sp|Q9NAH4|DENR_CAEEL Density-regulated protein homolog OS=Caenorhabditis elegans GN=Y47D3A.21 PE=3 SV=1 18 190 1.0E-22
sp|Q54WG0|DENR_DICDI Density-regulated protein homolog OS=Dictyostelium discoideum GN=denr PE=3 SV=1 1 193 1.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0006413 translational initiation Yes
GO:0003743 translation initiation factor activity Yes
GO:0008135 translation factor activity, RNA binding No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0045182 translation regulator activity No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7424 0.434 0.0908 0.0534 0.4625 0.0472 0.3287 0.0753 0.1625 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1925
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6116
Ophiocordyceps australis map64 (Brazil) OphauB2|2648
Ophiocordyceps camponoti-floridani Ophcf2|07323
Ophiocordyceps camponoti-rufipedis Ophun1|4435
Ophiocordyceps kimflemingae Ophio5|8366
Ophiocordyceps subramaniannii Hirsu2|2055 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2055
MADTEQPEAPAEPQARHVIYCGVCTLPPEYCEYGGTVKKCQEWLQNSHPAMYERIWSAEALEAATASLSVEAQVR
AAKDAQKKAAKAEAAEQKQADKLAKSVVTIKRIERNKKKFVTAVVGLEAFGLELKKVAKDLGKKFATGSSVTKVP
SGGEEIVVQGDVSEEVEEFLLEKYKEIPEDNIELVDDKKKKKAAAAAAAAK*
Coding >Hirsu2|2055
ATGGCAGACACAGAACAGCCGGAGGCCCCCGCGGAGCCTCAGGCCAGGCACGTCATCTATTGTGGCGTCTGCACG
CTCCCCCCCGAGTACTGTGAATATGGCGGCACCGTCAAGAAGTGCCAGGAGTGGCTGCAGAACAGCCATCCGGCC
ATGTACGAGCGCATCTGGTCTGCAGAGGCACTGGAAGCCGCGACCGCTTCGCTGTCCGTCGAGGCCCAGGTGAGA
GCGGCCAAGGATGCGCAGAAGAAGGCGGCCAAGGCGGAGGCGGCCGAGCAGAAGCAGGCCGACAAGCTCGCCAAG
AGTGTCGTCACCATCAAGCGCATCGAGCGCAACAAAAAGAAGTTCGTCACTGCCGTGGTAGGGCTGGAAGCTTTC
GGGCTCGAGCTGAAAAAGGTTGCCAAGGATCTCGGCAAGAAGTTTGCGACCGGATCGTCCGTGACCAAGGTTCCA
AGTGGCGGCGAGGAGATTGTCGTCCAGGGCGACGTCAGCGAGGAGGTGGAGGAGTTCCTCCTGGAGAAGTATAAG
GAGATACCCGAAGATAACATTGAGCTTGTCGACGACAAGAAGAAGAAAAAGGCGGCGGCCGCGGCGGCCGCGGCC
AAGTAA
Transcript >Hirsu2|2055
ATGGCAGACACAGAACAGCCGGAGGCCCCCGCGGAGCCTCAGGCCAGGCACGTCATCTATTGTGGCGTCTGCACG
CTCCCCCCCGAGTACTGTGAATATGGCGGCACCGTCAAGAAGTGCCAGGAGTGGCTGCAGAACAGCCATCCGGCC
ATGTACGAGCGCATCTGGTCTGCAGAGGCACTGGAAGCCGCGACCGCTTCGCTGTCCGTCGAGGCCCAGGTGAGA
GCGGCCAAGGATGCGCAGAAGAAGGCGGCCAAGGCGGAGGCGGCCGAGCAGAAGCAGGCCGACAAGCTCGCCAAG
AGTGTCGTCACCATCAAGCGCATCGAGCGCAACAAAAAGAAGTTCGTCACTGCCGTGGTAGGGCTGGAAGCTTTC
GGGCTCGAGCTGAAAAAGGTTGCCAAGGATCTCGGCAAGAAGTTTGCGACCGGATCGTCCGTGACCAAGGTTCCA
AGTGGCGGCGAGGAGATTGTCGTCCAGGGCGACGTCAGCGAGGAGGTGGAGGAGTTCCTCCTGGAGAAGTATAAG
GAGATACCCGAAGATAACATTGAGCTTGTCGACGACAAGAAGAAGAAAAAGGCGGCGGCCGCGGCGGCCGCGGCC
AAGTAA
Gene >Hirsu2|2055
ATGGCAGACACAGAACAGCCGGAGGCCCCCGCGGAGCCTCAGGCCAGGCACGTCATCTATTGTGGCGGTACGTCG
GCCGCCGGGAAACCGTCCCCGCCCCCGAGTCCCGTCGCTGACCCGGCCTCCTTCGGCGCCGTCACCAGTCTGCAC
GCTCCCCCCCGAGGTCTGCCGATTCCCACCCGGTCCCGGGGCGCGGGAGCGCTTGAGCTCCGGCTTCCTATGTCT
GACGCGGCAAGCAGTACTGTGAATATGGCGGCACCGTCAAGAAGTGCCAGGAGTGGCTGCAGAACAGCCATCCGG
CCATGTACGAGCGCATCTGGTCTGCAGGTCCGGTGCCCGTCTCCCGTCTCCCGTCTCCCCCCCCCCTCCCTTCCT
TGCCGCGCGACTGACGAGGGAGGGTGTCATCAGAGGCACTGGAAGCCGCGACCGCTTCGCTGTCCGTCGAGGCCC
AGGTGAGAGCGGCCAAGGATGCGCAGAAGAAGGCGGCCAAGGCGGAGGCGGCCGAGCAGAAGCAGGCCGACAAGC
TCGCCAAGAGTGTCGTCACCATCAAGCGCATCGAGCGCAACAAAAAGAAGTTCGTCACTGCCGTGGTAGGGCTGG
AAGCTTTCGGGCTCGAGCTGAAAAAGGTACATTGGAAGAAACTCTCCCATGCCACCTCCCCGCCGCCGTCGCTGT
CCCTTCTTCCCCAGTCCCACCCGCGCTCATCAAAAGAGGACAGGTTGCCAAGGATCTCGGCAAGAAGTTTGCGAC
CGGATCGTCCGTGACCAAGGTTCCAAGTGGCGGCGAGGAGATTGTCGTCCAGGGCGACGTCAGCGAGGAGGTGGA
GGAGTTCCTCCTGGAGAAGTATAAGGAGATACCCGAAGATAACATTGAGCTTGTCGACGACAAGAAGAAGAAAAA
GGCGGCGGCCGCGGCGGCCGCGGCCAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail