Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2044
Gene name
LocationContig_1477:2997..5584
Strand+
Gene length (bp)2587
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 8.1E-31 69 270

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53626|E13B_TRIHA Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum GN=bgn13.1 PE=1 SV=1 18 759 0.0E+00
sp|P49426|EXG1_COCCA Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum GN=EXG1 PE=1 SV=1 55 729 3.0E-60
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 343 732 4.0E-49
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 15 336 9.0E-16

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1083 0.0472 0.9154 0.1197 0.0565 0.028 0.278 0.3805 0.1857 0.0034

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99979

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH55 1.7E-202 25 748

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1922
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7266
Ophiocordyceps australis map64 (Brazil) OphauB2|4416
Ophiocordyceps camponoti-floridani Ophcf2|02246
Ophiocordyceps camponoti-rufipedis Ophun1|4731
Ophiocordyceps kimflemingae Ophio5|1122
Ophiocordyceps subramaniannii Hirsu2|2044 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2044
MLPFATAIVLLLGLASATPPPIRHAAGETAFWYANMNHTGPHRGHTPHLEGGHLYDVFKAVRPGDGDGIQKAINE
DNGGRRHGMWLASQPRVVYIPSGVYELKKTIYMNTDTILMGDPINPPVLKAAADFLGEPILVSGHDPTTLEKGEL
SFAVSLKNLVLDTTSVPGANAFTALYWGVAQAAQLQNVRITMGLASDGKGHSGIQLGRGSTLGLSDLRLEHGQNG
IWHGEQQQVAYKNIYFYQNAVGMLVTGGSTITIMASIFDTCQIGIQHTAGKAWIALIDSKSFNSGVTLVTAGPPS
FLIENFDKDTMTDIAQMAGKTLLRGARHVESFSYANTIGLNPPNGPVSPAGPQQQPRRPAALAPDGRYPAIPAPN
YGDKLASDFINVKDPLQNGGLVVRGDHSRDESGALNQILVRAARLNKIAYFPFGSYRVDSTLFVPPGSRIVGEAW
ATISGHGPFFKHENDPKPVVSVGRRGEVGVAQMQDMRVTVSGPLPGAILLQFNMAGRVPGEVAVWNSLVTVGGTR
GAAGLADGCRDPAKACKAAFIGMHFSRTSSAYVENVWNWVADHITEDYDGGASIAAKGGVLVESTRGTWLHGLGS
EHWWLYQLNLRRAQNVMISLLQAETNYEQGDNAQLVAPAPWKPDAGGWGDPDFSWCAPGDRRCRMGYANFIDGGS
DIYTYGSAAWAFFSGPGYQGCEALQCQQTMHWIKETPTNLRAYGLCAKDAEAVVRLGDGTRVRAQDGFLGSWPGS
GGGLVGRYTP*
Coding >Hirsu2|2044
ATGCTCCCGTTCGCCACGGCCATCGTCCTTTTGCTGGGTCTGGCTTCGGCTACGCCGCCGCCCATCCGTCATGCG
GCCGGGGAGACTGCTTTTTGGTATGCCAACATGAACCATACCGGTCCGCATCGTGGCCACACCCCACACCTCGAA
GGCGGCCATCTATACGACGTCTTCAAAGCGGTAAGGCCGGGCGACGGTGATGGCATCCAGAAAGCCATCAACGAA
GACAATGGTGGCAGGCGTCACGGCATGTGGTTGGCGTCTCAGCCCAGAGTCGTCTACATCCCCTCGGGCGTGTAC
GAGCTGAAGAAGACCATCTACATGAACACCGATACCATTCTCATGGGGGACCCGATCAATCCGCCCGTCTTGAAA
GCGGCCGCTGACTTTCTCGGCGAGCCAATTCTCGTCTCCGGCCATGATCCCACCACTCTCGAGAAGGGCGAGCTG
TCTTTCGCCGTCAGTCTGAAGAACTTGGTCTTGGACACGACCAGCGTCCCCGGAGCAAACGCGTTCACGGCGCTC
TACTGGGGCGTGGCCCAGGCCGCCCAGCTGCAGAACGTCCGGATCACCATGGGCCTGGCCAGCGACGGCAAGGGC
CACAGCGGCATCCAGCTCGGGCGCGGCTCGACCCTGGGCCTCTCCGACTTGCGCCTCGAGCACGGGCAGAACGGC
ATCTGGCACGGCGAGCAGCAACAGGTGGCCTACAAGAACATCTACTTCTACCAGAACGCCGTCGGCATGCTCGTC
ACCGGCGGTAGCACCATTACCATCATGGCCTCCATCTTCGACACGTGCCAGATCGGCATCCAGCACACGGCCGGC
AAGGCCTGGATCGCGCTGATCGACTCCAAGTCGTTCAACTCGGGCGTGACGCTGGTGACGGCGGGCCCGCCGTCC
TTCCTCATCGAGAACTTCGACAAGGACACGATGACGGACATTGCGCAGATGGCCGGCAAGACGCTCCTGCGCGGC
GCCAGGCACGTCGAGAGCTTCTCCTACGCCAACACGATCGGCCTGAACCCGCCGAACGGGCCGGTCTCGCCGGCC
GGCCCGCAGCAGCAGCCGCGCCGGCCGGCGGCCCTGGCGCCGGACGGGCGGTACCCGGCCATCCCCGCGCCCAAC
TACGGCGACAAGCTGGCCTCGGACTTCATCAACGTCAAGGACCCGCTGCAGAACGGCGGACTCGTCGTGCGCGGC
GACCACAGCAGGGACGAGTCGGGCGCGCTCAACCAGATCCTGGTGCGGGCGGCGCGGCTGAACAAGATTGCCTAC
TTCCCCTTTGGCAGCTACCGCGTCGACTCGACCCTCTTCGTCCCGCCGGGCTCGCGCATCGTCGGCGAGGCCTGG
GCCACCATCTCGGGTCACGGCCCCTTCTTCAAGCACGAGAACGACCCGAAGCCGGTGGTGTCGGTCGGCCGCAGG
GGGGAGGTGGGCGTGGCCCAGATGCAGGACATGCGCGTCACCGTGTCGGGCCCGCTGCCGGGCGCCATCCTGCTG
CAGTTCAACATGGCCGGCCGCGTGCCCGGCGAAGTGGCCGTGTGGAACTCGCTCGTCACGGTCGGGGGCACGCGG
GGGGCGGCCGGGCTGGCGGACGGGTGCCGGGACCCGGCCAAGGCGTGCAAGGCGGCCTTCATCGGCATGCACTTC
TCGCGCACGTCGTCGGCCTACGTCGAGAACGTGTGGAACTGGGTGGCGGACCACATCACCGAGGACTACGACGGC
GGGGCCAGCATCGCGGCCAAGGGCGGCGTCCTGGTCGAGTCGACCAGGGGCACCTGGCTCCACGGGCTGGGCAGC
GAGCACTGGTGGCTGTACCAGCTCAACCTGCGGCGGGCGCAGAACGTCATGATCTCGCTGCTGCAGGCCGAGACC
AACTACGAGCAGGGCGACAACGCGCAGCTGGTGGCGCCGGCGCCGTGGAAGCCCGACGCCGGCGGCTGGGGCGAC
CCGGACTTTTCGTGGTGCGCGCCGGGCGACAGGCGGTGCCGGATGGGCTACGCCAACTTCATCGACGGGGGGTCC
GACATCTACACGTACGGCTCGGCGGCCTGGGCCTTTTTCAGCGGGCCGGGCTATCAGGGCTGCGAGGCGTTGCAG
TGTCAACAGACGATGCACTGGATCAAGGAAACGCCAACGAACCTCAGGGCCTACGGGCTGTGCGCCAAGGACGCC
GAGGCGGTGGTGCGGCTGGGCGACGGGACCCGGGTCCGGGCGCAGGACGGCTTCCTCGGCTCGTGGCCGGGGAGC
GGCGGCGGCCTGGTGGGGCGATATACGCCGTAG
Transcript >Hirsu2|2044
ATGCTCCCGTTCGCCACGGCCATCGTCCTTTTGCTGGGTCTGGCTTCGGCTACGCCGCCGCCCATCCGTCATGCG
GCCGGGGAGACTGCTTTTTGGTATGCCAACATGAACCATACCGGTCCGCATCGTGGCCACACCCCACACCTCGAA
GGCGGCCATCTATACGACGTCTTCAAAGCGGTAAGGCCGGGCGACGGTGATGGCATCCAGAAAGCCATCAACGAA
GACAATGGTGGCAGGCGTCACGGCATGTGGTTGGCGTCTCAGCCCAGAGTCGTCTACATCCCCTCGGGCGTGTAC
GAGCTGAAGAAGACCATCTACATGAACACCGATACCATTCTCATGGGGGACCCGATCAATCCGCCCGTCTTGAAA
GCGGCCGCTGACTTTCTCGGCGAGCCAATTCTCGTCTCCGGCCATGATCCCACCACTCTCGAGAAGGGCGAGCTG
TCTTTCGCCGTCAGTCTGAAGAACTTGGTCTTGGACACGACCAGCGTCCCCGGAGCAAACGCGTTCACGGCGCTC
TACTGGGGCGTGGCCCAGGCCGCCCAGCTGCAGAACGTCCGGATCACCATGGGCCTGGCCAGCGACGGCAAGGGC
CACAGCGGCATCCAGCTCGGGCGCGGCTCGACCCTGGGCCTCTCCGACTTGCGCCTCGAGCACGGGCAGAACGGC
ATCTGGCACGGCGAGCAGCAACAGGTGGCCTACAAGAACATCTACTTCTACCAGAACGCCGTCGGCATGCTCGTC
ACCGGCGGTAGCACCATTACCATCATGGCCTCCATCTTCGACACGTGCCAGATCGGCATCCAGCACACGGCCGGC
AAGGCCTGGATCGCGCTGATCGACTCCAAGTCGTTCAACTCGGGCGTGACGCTGGTGACGGCGGGCCCGCCGTCC
TTCCTCATCGAGAACTTCGACAAGGACACGATGACGGACATTGCGCAGATGGCCGGCAAGACGCTCCTGCGCGGC
GCCAGGCACGTCGAGAGCTTCTCCTACGCCAACACGATCGGCCTGAACCCGCCGAACGGGCCGGTCTCGCCGGCC
GGCCCGCAGCAGCAGCCGCGCCGGCCGGCGGCCCTGGCGCCGGACGGGCGGTACCCGGCCATCCCCGCGCCCAAC
TACGGCGACAAGCTGGCCTCGGACTTCATCAACGTCAAGGACCCGCTGCAGAACGGCGGACTCGTCGTGCGCGGC
GACCACAGCAGGGACGAGTCGGGCGCGCTCAACCAGATCCTGGTGCGGGCGGCGCGGCTGAACAAGATTGCCTAC
TTCCCCTTTGGCAGCTACCGCGTCGACTCGACCCTCTTCGTCCCGCCGGGCTCGCGCATCGTCGGCGAGGCCTGG
GCCACCATCTCGGGTCACGGCCCCTTCTTCAAGCACGAGAACGACCCGAAGCCGGTGGTGTCGGTCGGCCGCAGG
GGGGAGGTGGGCGTGGCCCAGATGCAGGACATGCGCGTCACCGTGTCGGGCCCGCTGCCGGGCGCCATCCTGCTG
CAGTTCAACATGGCCGGCCGCGTGCCCGGCGAAGTGGCCGTGTGGAACTCGCTCGTCACGGTCGGGGGCACGCGG
GGGGCGGCCGGGCTGGCGGACGGGTGCCGGGACCCGGCCAAGGCGTGCAAGGCGGCCTTCATCGGCATGCACTTC
TCGCGCACGTCGTCGGCCTACGTCGAGAACGTGTGGAACTGGGTGGCGGACCACATCACCGAGGACTACGACGGC
GGGGCCAGCATCGCGGCCAAGGGCGGCGTCCTGGTCGAGTCGACCAGGGGCACCTGGCTCCACGGGCTGGGCAGC
GAGCACTGGTGGCTGTACCAGCTCAACCTGCGGCGGGCGCAGAACGTCATGATCTCGCTGCTGCAGGCCGAGACC
AACTACGAGCAGGGCGACAACGCGCAGCTGGTGGCGCCGGCGCCGTGGAAGCCCGACGCCGGCGGCTGGGGCGAC
CCGGACTTTTCGTGGTGCGCGCCGGGCGACAGGCGGTGCCGGATGGGCTACGCCAACTTCATCGACGGGGGGTCC
GACATCTACACGTACGGCTCGGCGGCCTGGGCCTTTTTCAGCGGGCCGGGCTATCAGGGCTGCGAGGCGTTGCAG
TGTCAACAGACGATGCACTGGATCAAGGAAACGCCAACGAACCTCAGGGCCTACGGGCTGTGCGCCAAGGACGCC
GAGGCGGTGGTGCGGCTGGGCGACGGGACCCGGGTCCGGGCGCAGGACGGCTTCCTCGGCTCGTGGCCGGGGAGC
GGCGGCGGCCTGGTGGGGCGATATACGCCGTAG
Gene >Hirsu2|2044
ATGCTCCCGTTCGCCACGGCCATCGTCCTTTTGCTGGGTCTGGCTTCGGCTACGCCGCCGCCCATCCGTCATGCG
GCCGGGGAGACTGCTTTTTGGTATGCCAACATGAACCATACCGGTCCGCATCGTGGCCACACCCCACACCTCGAA
GGCGGCCATCTATACGACGTCTTCAAAGCGGTAAGGCCGGGCGACGGTGATGGCATCCAGAAAGCCATCAACGAA
GACAATGGTGGCAGGCGTCACGGCATGTGGTTGGCGTCTCAGCCCAGAGTACGTCGCCTGCTCGCACGACAGCAG
CTCGTGTCTCCTTCCTCGCTCACATGACGCAGGTCGTCTACATCCCCTCGGGCGTGTACGAGCTGAAGAAGACCA
TCTACATGAACACCGATACCATTCTCATGGGGGACCCGATCAATGTACGAGTCGGCCCGTCCCCCGCCCAAGCCG
ATAGAGCCGACTGACACTTGCTCCCCTCAGCCGCCCGTCTTGAAAGCGGCCGCTGACTTTCTCGGCGAGCCAATT
CTCGTCTCCGGTGAGCCCCATCTCCTCGTACGCGGCTTGTGAGGCGGCAGCTGACGACCCGGCACAGGCCATGAT
CCCACCACTCTCGAGAAGGGCGAGCTGTCTTTCGCCGTCAGTCTGAAGAACTTGGTCTTGGACACGACCAGCGTC
CCCGGAGGCGAGCAGCCCCTGTTCCCGGCCCCGGCTTCTCCCTGCGGACCTGGCTGACCGGGACGAGCAGCAAAC
GCGTTCACGGCGCTCTACTGGGGCGTGGCCCAGGCCGCCCAGCTGCAGAACGTCCGGATCACCATGGGCCTGGCC
AGCGACGGCAAGGGCCACAGCGGCATCCAGCTCGGGCGCGGCTCGACCCTGGGCCTCTCCGACTTGCGCCTCGAG
CACGGGCAGAACGGCATCTGGCACGGCGAGCAGCAACAGGTGGCCTACAAGAACATCTACTTCTACCAGAACGCC
GTCGGCATGCTCGTCACCGGCGGTAGCACCATTACCATCATGGCCTCCATCTTCGACACGTGCCAGATCGGCATC
CAGCACACGGCCGGCAAGGCCTGGATCGCGCTGATCGACTCCAAGTCGTTCAACTCGGGCGTGACGCTGGTGACG
GCGGGCCCGCCGTCCTTCCTCATCGAGAACTTCGACAAGGACACGATGACGGACATTGCGCAGATGGCCGGCAAG
ACGCTCCTGCGCGGCGCCAGGCACGTCGAGAGCTTCTCCTACGCCAACACGATCGGCCTGAACCCGCCGAACGGG
CCGGTCTCGCCGGCCGGCCCGCAGCAGCAGCCGCGCCGGCCGGCGGCCCTGGCGCCGGACGGGCGGTACCCGGCC
ATCCCCGCGCCCAACTACGGCGACAAGCTGGCCTCGGACTTCATCAACGTCAAGGACCCGCTGCAGAACGGCGGA
CTCGTCGTGCGCGGCGACCACAGCAGGGACGAGTCGGGCGCGCTCAACCAGATCCTGGTGCGGGCGGCGCGGCTG
AACAAGATTGCCTACTTCCCCTTTGGCAGCTACCGCGTCGACTCGACCCTCTTCGTCCCGCCGGGCTCGCGCATC
GTCGGCGAGGCCTGGGCCACCATCTCGGGTCACGGCCCCTTCTTCAAGCACGAGAACGACCCGAAGCCGGTGGTG
TCGGTCGGCCGCAGGGGGGAGGTGGGCGTGGCCCAGATGCAGGACATGCGCGTCACCGTGTCGGGCCCGCTGCCG
GGCGCCATCCTGCTGCAGTTCAACATGGCCGGCCGCGTGCCCGGCGAAGTGGCCGTGTGGAACTCGCTCGTCACG
GTCGGGGGCACGCGGGGGGCGGCCGGGCTGGCGGACGGGTGCCGGGACCCGGCCAAGGCGTGCAAGGCGGCCTTC
ATCGGCATGCACTTCTCGCGCACGTCGTCGGCCTACGTCGAGAACGTGTGGAACTGGGTGGCGGACCACATCACC
GAGGACTACGACGGCGGGGCCAGCATCGCGGCCAAGGGCGGCGTCCTGGTCGAGTCGACCAGGGGCACCTGGCTC
CACGGGCTGGGCAGCGAGCACTGGTGGCTGTACCAGCTCAACCTGCGGCGGGCGCAGAACGTCATGATCTCGCTG
CTGCAGGCCGAGACCAACTACGAGCAGGGCGACAACGCGCAGCTGGTGGCGCCGGCGCCGTGGAAGCCCGACGCC
GGCGGCTGGGGCGACCCGGACTTTTCGTGGTGCGCGCCGGGCGACAGGCGGTGCCGGATGGGCTACGCCAACTTC
ATCGACGGGGGGTCCGACATCTACACGTACGGCTCGGCGGCCTGGGCCTTTTTCAGCGGGCCGGGCTATCAGGGC
TGCGAGGCGTTGCAGTGTCAACGTAGGTTTTGTTGTCGGAAACGGAAGGCGCAGAGCGGACGAAAGCTGACTATG
CTACCATGCAGAGACGATGCACTGGATCAAGGAAACGCCAACGAACCTCAGGGCCTACGGGCTGTGCGCCAAGGA
CGCCGAGGCGGTGGTGCGGCTGGGCGACGGGACCCGGGTCCGGGCGCAGGACGGCTTCCTCGGCTCGTGGCCGGG
GAGCGGCGGCGGCCTGGTGGGGCGATATACGCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail