Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2043
Gene name
LocationContig_1477:965..1438
Strand-
Gene length (bp)473
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12907 zf-met2 Zinc-binding 2.6E-16 35 70
PF04419 4F5 4F5 protein family 2.3E-07 1 32

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64818|Y2309_ARATH Uncharacterized protein At2g23090 OS=Arabidopsis thaliana GN=At2g23090 PE=1 SV=1 2 69 8.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2043
MGNGAKAQQKRERNQKDGKTAKSQLKENEKAMSIQCQVCKATFLQTTKAPALLEHASNKHNKGLADCFPSKA*
Coding >Hirsu2|2043
ATGGGCAACGGAGCCAAGGCACAGCAGAAGCGCGAGCGCAACCAGAAGGACGGAAAGACGGCCAAGTCGCAACTC
AAGGAGAACGAGAAGGCCATGAGCATCCAGTGCCAAGTCTGCAAGGCCACCTTCCTCCAGACCACCAAGGCCCCT
GCCCTCCTCGAACATGCGTCGAATAAGCACAACAAAGGCCTAGCCGACTGCTTTCCCAGCAAGGCCTGA
Transcript >Hirsu2|2043
ATGGGCAACGGAGCCAAGGCACAGCAGAAGCGCGAGCGCAACCAGAAGGACGGAAAGACGGCCAAGTCGCAACTC
AAGGAGAACGAGAAGGCCATGAGCATCCAGTGCCAAGTCTGCAAGGCCACCTTCCTCCAGACCACCAAGGCCCCT
GCCCTCCTCGAACATGCGTCGAATAAGCACAACAAAGGCCTAGCCGACTGCTTTCCCAGCAAGGCCTGA
Gene >Hirsu2|2043
ATGGGCAACGTAGGGACCGTTCCCAACCCCTGTTTTTTTTTTTTTACTTGTCTGCCGTGAATAGACCCGGCTGAC
CTGCTGGGAAAAACTCAACGCGATGGAATGCCTAGGGAGCCAAGGCACAGCAGAAGCGCGAGCGCAACCAGAAGG
ACGGAAAGACGGCCAAGTCGCAACTCAAGGAGGTACGTTCTGCAGACCCCACCAATGCGCCTCTACCGTCCGTTT
GGTGTTGACCGGCCGCGGCTTCGGTATAGAACGAGAAGGCCATGAGCATCCAGTGCCAAGTCTGCAAGGCCACCT
TCCTCCAGACCACCAAGGCCCCTGCGTGCGTGACGCCCTTCCATCTCCCCTCACACCCCCCCTGGCATCTGCTGA
CATGCCCCCGCGTCCTGTCTCTCGTCGATAGCCTCCTCGAACATGCGTCGAATAAGCACAACAAAGGCCTAGCCG
ACTGCTTTCCCAGCAAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail