Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2040
Gene name
LocationContig_1474:3680..6024
Strand-
Gene length (bp)2344
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 7.3E-03 610 635

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 545 639 4.0E-09
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 545 639 2.0E-08
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 545 639 4.0E-07
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 545 639 5.0E-07
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 545 639 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 545 639 4.0E-09
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 545 639 2.0E-08
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 545 639 4.0E-07
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 545 639 5.0E-07
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 545 639 5.0E-07
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 543 633 7.0E-07
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 499 662 1.0E-06
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 541 635 2.0E-06
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 421 635 2.0E-06
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 521 666 2.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 541 635 2.0E-06
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 505 635 2.0E-06
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 475 635 2.0E-06
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 529 636 4.0E-06
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 529 636 4.0E-06
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 542 635 5.0E-06
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 529 635 6.0E-06
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 542 635 7.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 541 635 7.0E-06
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 504 635 8.0E-06
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 421 635 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2040
MHAGHSCACPSNWPSIIRSRKGAALRRLSRPPPYSTKILISGVQRVHRWHLGPLLLRGTLAISTYHPFYLPGDAP
HICFTVRFIRTGEQSIAFLAGHGKPQAIEKYLQRSSAARSTSAPSPFFLFPAYQQHYPSSLHNPSLPGPFPSRCC
NPPTLASAASSPPNARYRPLGPWPAEKSSHRKAMTTATRQQQQQPQSFPAADTFDPDEVVPRDSPLMQALRPKLE
LSPSPTPDIPPAQIRPSSGDAVLVSYLDNGRHPDIARAAGAQALPGVDDDGDGDAGPRPGSSNTGPCTAVCGPDG
SQTPHRAITTPILQNMAADALQAVSAETPSIPPLRETPDISASTRQLSISDGRSCKSTTYSSSTHTSRPSVQLKT
GAKSPTPALTPACGELPPLQMVSPKSESNGQSLPSIRSTFGDIKHIPSELRTPADTDLTPMSGATAAFSRSPSGA
RPRLPLMSATHVSPPISPSEAYQRSLPSPHSLPASSPFGFYQTNGLGQRPNTEFIGTATAETPSTDQSASTPATS
ASVADRMSIDGLTNPQVGVYVCNFSGCSAPPFQTQYLLNSHANVHSSARPHYCPVKGCPRSEGGKGFKRKNEMIR
HGLVHDSPGYVCPFCPDREHKYPRPDNLQRHVRVHHVDKDKDDPLLREVLSQRPDGPSRGRRRRGVAA*
Coding >Hirsu2|2040
ATGCACGCCGGGCACTCCTGCGCCTGTCCTTCAAACTGGCCGAGCATTATCCGCTCCCGCAAGGGCGCTGCACTG
CGACGTCTGTCCCGACCGCCGCCCTATTCCACCAAAATTCTCATCTCAGGTGTGCAACGAGTACACCGTTGGCAC
CTAGGGCCCTTGCTGCTCCGAGGCACGCTCGCCATATCTACATATCATCCGTTCTATCTACCCGGAGACGCCCCC
CACATTTGCTTTACAGTCCGATTCATTCGCACGGGCGAGCAATCCATCGCGTTTCTTGCCGGCCACGGCAAGCCC
CAAGCCATTGAAAAATATTTACAACGGTCATCTGCCGCACGATCGACTTCCGCACCTTCGCCCTTCTTCCTCTTC
CCCGCCTATCAGCAGCATTACCCCTCTAGTCTTCATAACCCGTCGTTGCCCGGCCCATTTCCGTCGCGCTGCTGC
AACCCGCCTACTCTTGCCAGCGCTGCGTCGAGCCCCCCAAACGCCAGATACCGGCCTCTTGGGCCATGGCCGGCT
GAGAAGTCCTCGCATCGGAAAGCTATGACGACAGCCACGCGACAGCAGCAGCAGCAGCCCCAATCCTTCCCGGCT
GCCGACACATTTGACCCAGATGAAGTAGTCCCGCGGGACAGTCCCCTCATGCAAGCGCTACGTCCAAAACTCGAA
CTGTCACCGAGCCCGACGCCGGACATCCCTCCGGCACAAATTCGTCCCAGCTCCGGGGATGCCGTGCTCGTTTCT
TATCTCGACAATGGCCGCCATCCCGACATCGCCCGTGCCGCCGGAGCGCAGGCTTTGCCTGGCGTTGACGATGAC
GGGGACGGCGACGCTGGCCCGCGACCTGGCTCCTCCAACACTGGACCTTGCACGGCTGTCTGCGGCCCTGATGGC
TCGCAAACTCCCCATAGGGCAATAACGACCCCGATCCTGCAAAATATGGCTGCCGACGCTCTGCAAGCAGTTTCT
GCGGAAACGCCGTCAATCCCGCCTTTGAGGGAGACACCGGATATTTCCGCTTCGACTCGCCAGTTGTCCATCAGC
GATGGGCGATCTTGTAAAAGTACAACGTACTCCTCTTCCACGCATACGAGTAGACCTTCTGTTCAACTCAAGACG
GGGGCCAAATCACCTACACCGGCGTTGACGCCTGCTTGTGGCGAGCTACCCCCCCTCCAGATGGTGTCTCCCAAA
TCGGAGTCAAACGGTCAAAGCCTGCCCTCCATACGGTCTACCTTCGGCGATATCAAACACATACCTTCTGAGCTG
CGGACACCGGCTGATACAGATTTGACGCCTATGTCCGGCGCGACGGCGGCCTTTTCGCGGTCCCCATCAGGCGCT
AGACCACGGTTGCCTCTAATGTCAGCCACGCATGTCTCGCCTCCAATATCACCAAGCGAAGCTTATCAACGCAGC
CTGCCATCACCGCACTCATTGCCAGCTTCAAGCCCCTTCGGCTTCTACCAGACAAACGGGCTGGGCCAGCGGCCT
AATACTGAATTCATTGGCACCGCAACGGCCGAGACGCCCAGTACGGACCAATCTGCCTCAACGCCCGCCACTTCC
GCGTCGGTAGCAGATCGGATGAGTATCGACGGTCTCACCAATCCGCAAGTCGGTGTGTACGTTTGCAACTTCTCG
GGTTGCTCGGCCCCCCCGTTCCAAACTCAGTATCTTCTCAACTCTCATGCAAACGTCCACTCATCCGCGCGCCCT
CATTATTGTCCAGTCAAGGGATGTCCCCGAAGTGAGGGAGGCAAGGGATTCAAGCGGAAAAATGAAATGATCAGG
CATGGGCTGGTCCACGATTCGCCGGGCTATGTGTGCCCTTTCTGTCCAGATAGAGAACACAAATACCCTCGACCC
GATAATCTCCAAAGACATGTTCGTGTCCATCACGTCGACAAGGACAAGGACGACCCCTTGCTGCGCGAGGTTCTG
TCTCAAAGGCCCGATGGTCCAAGCCGGGGTCGCCGAAGACGAGGCGTCGCCGCCTAG
Transcript >Hirsu2|2040
ATGCACGCCGGGCACTCCTGCGCCTGTCCTTCAAACTGGCCGAGCATTATCCGCTCCCGCAAGGGCGCTGCACTG
CGACGTCTGTCCCGACCGCCGCCCTATTCCACCAAAATTCTCATCTCAGGTGTGCAACGAGTACACCGTTGGCAC
CTAGGGCCCTTGCTGCTCCGAGGCACGCTCGCCATATCTACATATCATCCGTTCTATCTACCCGGAGACGCCCCC
CACATTTGCTTTACAGTCCGATTCATTCGCACGGGCGAGCAATCCATCGCGTTTCTTGCCGGCCACGGCAAGCCC
CAAGCCATTGAAAAATATTTACAACGGTCATCTGCCGCACGATCGACTTCCGCACCTTCGCCCTTCTTCCTCTTC
CCCGCCTATCAGCAGCATTACCCCTCTAGTCTTCATAACCCGTCGTTGCCCGGCCCATTTCCGTCGCGCTGCTGC
AACCCGCCTACTCTTGCCAGCGCTGCGTCGAGCCCCCCAAACGCCAGATACCGGCCTCTTGGGCCATGGCCGGCT
GAGAAGTCCTCGCATCGGAAAGCTATGACGACAGCCACGCGACAGCAGCAGCAGCAGCCCCAATCCTTCCCGGCT
GCCGACACATTTGACCCAGATGAAGTAGTCCCGCGGGACAGTCCCCTCATGCAAGCGCTACGTCCAAAACTCGAA
CTGTCACCGAGCCCGACGCCGGACATCCCTCCGGCACAAATTCGTCCCAGCTCCGGGGATGCCGTGCTCGTTTCT
TATCTCGACAATGGCCGCCATCCCGACATCGCCCGTGCCGCCGGAGCGCAGGCTTTGCCTGGCGTTGACGATGAC
GGGGACGGCGACGCTGGCCCGCGACCTGGCTCCTCCAACACTGGACCTTGCACGGCTGTCTGCGGCCCTGATGGC
TCGCAAACTCCCCATAGGGCAATAACGACCCCGATCCTGCAAAATATGGCTGCCGACGCTCTGCAAGCAGTTTCT
GCGGAAACGCCGTCAATCCCGCCTTTGAGGGAGACACCGGATATTTCCGCTTCGACTCGCCAGTTGTCCATCAGC
GATGGGCGATCTTGTAAAAGTACAACGTACTCCTCTTCCACGCATACGAGTAGACCTTCTGTTCAACTCAAGACG
GGGGCCAAATCACCTACACCGGCGTTGACGCCTGCTTGTGGCGAGCTACCCCCCCTCCAGATGGTGTCTCCCAAA
TCGGAGTCAAACGGTCAAAGCCTGCCCTCCATACGGTCTACCTTCGGCGATATCAAACACATACCTTCTGAGCTG
CGGACACCGGCTGATACAGATTTGACGCCTATGTCCGGCGCGACGGCGGCCTTTTCGCGGTCCCCATCAGGCGCT
AGACCACGGTTGCCTCTAATGTCAGCCACGCATGTCTCGCCTCCAATATCACCAAGCGAAGCTTATCAACGCAGC
CTGCCATCACCGCACTCATTGCCAGCTTCAAGCCCCTTCGGCTTCTACCAGACAAACGGGCTGGGCCAGCGGCCT
AATACTGAATTCATTGGCACCGCAACGGCCGAGACGCCCAGTACGGACCAATCTGCCTCAACGCCCGCCACTTCC
GCGTCGGTAGCAGATCGGATGAGTATCGACGGTCTCACCAATCCGCAAGTCGGTGTGTACGTTTGCAACTTCTCG
GGTTGCTCGGCCCCCCCGTTCCAAACTCAGTATCTTCTCAACTCTCATGCAAACGTCCACTCATCCGCGCGCCCT
CATTATTGTCCAGTCAAGGGATGTCCCCGAAGTGAGGGAGGCAAGGGATTCAAGCGGAAAAATGAAATGATCAGG
CATGGGCTGGTCCACGATTCGCCGGGCTATGTGTGCCCTTTCTGTCCAGATAGAGAACACAAATACCCTCGACCC
GATAATCTCCAAAGACATGTTCGTGTCCATCACGTCGACAAGGACAAGGACGACCCCTTGCTGCGCGAGGTTCTG
TCTCAAAGGCCCGATGGTCCAAGCCGGGGTCGCCGAAGACGAGGCGTCGCCGCCTAG
Gene >Hirsu2|2040
ATGCACGCCGGGCACTCCTGCGCCTGTCCTTCAAACTGGCCGAGCATTATCCGCTCCCGCAAGGGCGCTGCACTG
CGACGTCTGTCCCGACCGCCGCCCTATTCCACCAAAATTCTCATCTCAGGTGTGCAACGAGTACACCGTTGGCAC
CTAGGTAGGCGAGTCGACCCTCCGTCTCCACGGCTCGCAGCCCATCGGCACTTCCCGGCCTTCTCCACGCCGATC
CGTCGCCAACAGCAACACGACATCCTTCTCTCCAAGCTAGGCCCTTAACAACCAAACCCCCCCCCTCTTTTTCAT
CCTTTTATATTCCTTGATTCGCCCTGCGAAAGCGTGCCATTCAGCTGCGCATAGCTGCGAGCAGCTGCCTTCGGT
CTTTTAGGGCCCTTGCTGCTCCGAGGCACGCTCGCCATATCTACATATCATCCGTTCTATCTACCCGGAGACGCC
CCCCACATTTGCTTTACAGTCCGATTCATTCGCACGGGCGAGCAATCCATCGCGTTTCTTGCCGGCCACGGCAAG
CCCCAAGCCATTGAAAAATATTTACAACGGTCATCTGCCGCACGATCGACTTCCGCACCTTCGCCCTTCTTCCTC
TTCCCCGCCTATCAGCAGCATTACCCCTCTAGTCTTCATAACCCGTCGTTGCCCGGCCCATTTCCGTCGCGCTGC
TGCAACCCGCCTACTCTTGCCAGCGCTGCGTCGAGCCCCCCAAACGCCAGATACCGGCCTCTTGGGCCATGGCCG
GCTGAGAAGTCCTCGCATCGGAAAGCTATGACGACAGCCACGCGACAGCAGCAGCAGCAGCCCCAATCCTTCCCG
GCTGCCGACACATTTGACCCAGATGAAGTAGTCCCGCGGGACAGTCCCCTCATGCAAGCGCTACGTCCAAAACTC
GAACTGTCACCGAGCCCGACGCCGGACATCCCTCCGGCACAAGTCAGTCTGAGCCCTTCTCCCACTGACGGCCAC
TCCAACTCTAATCGGTCCAAGATTCGTCCCAGCTCCGGGGATGCCGTGCTCGTTTCTTATCTCGACAATGGCCGC
CATCCCGACATCGCCCGTGCCGCCGGAGCGCAGGCTTTGCCTGGCGTTGACGATGACGGGGACGGCGACGCTGGC
CCGCGACCTGGCTCCTCCAACACTGGACCTTGCACGGCTGTCTGCGGCCCTGATGGCTCGCAAACTCCCCATAGG
GCAATAACGACCCCGATCCTGCAAAATATGGCTGCCGACGCTCTGCAAGCAGTTTCTGCGGAAACGCCGTCAATC
CCGCCTTTGAGGGAGACACCGGATATTTCCGCTTCGACTCGCCAGTTGTCCATCAGCGATGGGCGATCTTGTAAA
AGTACAACGTACTCCTCTTCCACGCATACGAGTAGACCTTCTGTTCAACTCAAGACGGGGGCCAAATCACCTACA
CCGGCGTTGACGCCTGCTTGTGGCGAGCTACCCCCCCTCCAGATGGTGTCTCCCAAATCGGAGTCAAACGGTCAA
AGCCTGCCCTCCATACGGTCTACCTTCGGCGATATCAAACACATACCTTCTGAGCTGCGGACACCGGCTGATACA
GATTTGACGCCTATGTCCGGCGCGACGGCGGCCTTTTCGCGGTCCCCATCAGGCGCTAGACCACGGTTGCCTCTA
ATGTCAGCCACGCATGTCTCGCCTCCAATATCACCAAGCGAAGCTTATCAACGCAGCCTGCCATCACCGCACTCA
TTGCCAGCTTCAAGCCCCTTCGGCTTCTACCAGACAAACGGGCTGGGCCAGCGGCCTAATACTGAATTCATTGGC
ACCGCAACGGCCGAGACGCCCAGTACGGACCAATCTGCCTCAACGCCCGCCACTTCCGCGTCGGTAGCAGATCGG
ATGAGTATCGACGGTCTCACCAATCCGCAAGTCGGTGTGTACGTTTGCAACTTCTCGGGTTGCTCGGCCCCCCCG
TTCCAAACTCAGTATCTTCTCAACTCTCATGCAAACGTCCACTCATCCGCGCGCCCTCATTATTGTCCAGTCAAG
GGATGTCCCCGAAGTGAGGGAGGCAAGGGATTCAAGCGGAAAAATGAAATGATCAGGCATGGGCTGGTCCACGAT
TCGCCGGGCTATGTGTGCCCTTTCTGTCCAGATAGAGAACACAAATACCCTCGACCCGATAATCTCCAAAGGTGT
GCTCAGGCCTGTGATGATGCCGGGGTAAGGAAGGCTGACGTTGTACCCTAGACATGTTCGTGTCCATCACGTCGA
CAAGGACAAGGACGACCCCTTGCTGCGCGAGGTTCTGTCTCAAAGGCCCGATGGTCCAAGCCGGGGTCGCCGAAG
ACGAGGCGTCGCCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail