Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2036
Gene name
LocationContig_1473:1177..2554
Strand-
Gene length (bp)1377
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-28 95 342
PF00083 Sugar_tr Sugar (and other) transporter 5.9E-07 102 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 8 348 1.0E-48
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 13 350 4.0E-46
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 65 350 9.0E-45
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 26 350 1.0E-42
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 61 348 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 8 348 1.0E-48
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 13 350 4.0E-46
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 65 350 9.0E-45
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 26 350 1.0E-42
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 61 348 2.0E-42
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 14 348 3.0E-39
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 75 344 5.0E-39
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 75 344 5.0E-39
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 75 345 8.0E-39
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 73 345 2.0E-38
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 73 345 2.0E-38
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 72 350 3.0E-38
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 72 347 2.0E-37
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 75 345 3.0E-37
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 73 346 3.0E-36
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 67 349 5.0E-36
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 75 348 3.0E-35
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 94 347 5.0E-35
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 73 346 5.0E-35
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 71 349 9.0E-34
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 78 349 1.0E-31
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 115 349 3.0E-31
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 60 349 5.0E-31
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 75 349 1.0E-29
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 66 350 4.0E-29
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 28 349 1.0E-20
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 75 274 2.0E-16
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 349 3.0E-16
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 108 296 3.0E-16
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 64 278 4.0E-15
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 128 349 1.0E-13
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 40 282 6.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 108 302 1.0E-09
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 105 267 3.0E-09
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 84 244 9.0E-09
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 84 244 1.0E-08
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 73 243 5.0E-08
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 108 253 1.0E-07
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 85 277 3.0E-07
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 108 297 2.0E-06
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 73 269 2.0E-06
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 72 243 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 88 110 22
2 130 152 22
3 173 195 22
4 215 237 22
5 244 263 19
6 323 345 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2036
MSDVVRARSPSARPSQTSGEAAAAIQDDQDEADATPESLPVGAARPTPASLPHSGIAASIASRLPDFEVILEDGD
ADNPKSWPIRYRGWCIVAVSLSTWVVTLLSTSYSASLTGLADEFGATTTLVALGMTTYLLGLAVGTLILAPMGEL
YGRRVVYIVCLSSWALLNVPCGLAHSLTAIIVIRFFGACLGAVTISNGPGTVVDVSHPEYLARAMSLFGFAPFNG
PVTAPIIGGFVFQYMGWRWANWIVLIIAGVCIALVLTVEETYAPTILKRKAARLRRQTGDPRWWCRYDQRRVSTL
QLLRVNLSRPFILFATEPILWFMNLWISIAYSILYFCFIAYPVVFSQHRG*
Coding >Hirsu2|2036
ATGTCGGACGTAGTTCGTGCCCGCAGCCCTTCGGCGAGGCCGAGCCAGACGTCTGGAGAAGCAGCGGCAGCGATC
CAAGACGACCAAGATGAAGCCGACGCGACTCCCGAAAGCCTGCCCGTCGGGGCAGCACGCCCCACTCCCGCATCC
CTCCCTCACTCCGGGATTGCTGCCAGCATTGCCTCTCGCCTTCCCGATTTCGAAGTGATCCTGGAGGATGGCGAT
GCCGACAACCCCAAAAGCTGGCCGATCAGGTATCGCGGCTGGTGCATTGTGGCCGTCTCCCTTTCGACCTGGGTC
GTCACCCTTCTCAGCACCAGCTACAGTGCCTCGCTCACCGGCCTCGCCGACGAGTTTGGCGCCACGACGACCCTC
GTCGCGCTCGGCATGACCACCTATCTGCTCGGCCTAGCAGTCGGCACCCTTATTTTGGCCCCCATGGGCGAGCTC
TACGGCCGCCGCGTGGTCTACATCGTCTGCCTGTCCTCTTGGGCACTTTTGAATGTTCCTTGCGGCCTCGCCCAC
TCCTTGACGGCAATCATTGTCATCCGCTTCTTTGGGGCCTGTCTCGGCGCCGTCACCATATCCAATGGCCCCGGC
ACTGTCGTCGACGTCTCACACCCCGAATACCTTGCCAGGGCTATGTCGCTCTTCGGCTTCGCCCCATTCAACGGC
CCCGTCACGGCACCCATCATCGGCGGCTTTGTCTTCCAGTACATGGGATGGCGATGGGCCAACTGGATCGTCCTG
ATCATCGCGGGCGTCTGTATCGCTCTCGTACTGACGGTCGAAGAGACGTACGCGCCCACGATTTTGAAGCGCAAG
GCCGCGCGGCTGCGGAGGCAGACGGGCGATCCCAGATGGTGGTGTCGGTACGACCAACGGAGAGTCTCGACTCTG
CAACTGCTTCGAGTGAACTTGAGCCGGCCTTTTATCCTGTTCGCCACAGAGCCCATTCTGTGGTTCATGAATCTC
TGGATCTCCATCGCCTACAGCATCTTGTACTTCTGCTTCATAGCCTACCCTGTTGTCTTCTCCCAACATCGAGGA
TAG
Transcript >Hirsu2|2036
ATGTCGGACGTAGTTCGTGCCCGCAGCCCTTCGGCGAGGCCGAGCCAGACGTCTGGAGAAGCAGCGGCAGCGATC
CAAGACGACCAAGATGAAGCCGACGCGACTCCCGAAAGCCTGCCCGTCGGGGCAGCACGCCCCACTCCCGCATCC
CTCCCTCACTCCGGGATTGCTGCCAGCATTGCCTCTCGCCTTCCCGATTTCGAAGTGATCCTGGAGGATGGCGAT
GCCGACAACCCCAAAAGCTGGCCGATCAGGTATCGCGGCTGGTGCATTGTGGCCGTCTCCCTTTCGACCTGGGTC
GTCACCCTTCTCAGCACCAGCTACAGTGCCTCGCTCACCGGCCTCGCCGACGAGTTTGGCGCCACGACGACCCTC
GTCGCGCTCGGCATGACCACCTATCTGCTCGGCCTAGCAGTCGGCACCCTTATTTTGGCCCCCATGGGCGAGCTC
TACGGCCGCCGCGTGGTCTACATCGTCTGCCTGTCCTCTTGGGCACTTTTGAATGTTCCTTGCGGCCTCGCCCAC
TCCTTGACGGCAATCATTGTCATCCGCTTCTTTGGGGCCTGTCTCGGCGCCGTCACCATATCCAATGGCCCCGGC
ACTGTCGTCGACGTCTCACACCCCGAATACCTTGCCAGGGCTATGTCGCTCTTCGGCTTCGCCCCATTCAACGGC
CCCGTCACGGCACCCATCATCGGCGGCTTTGTCTTCCAGTACATGGGATGGCGATGGGCCAACTGGATCGTCCTG
ATCATCGCGGGCGTCTGTATCGCTCTCGTACTGACGGTCGAAGAGACGTACGCGCCCACGATTTTGAAGCGCAAG
GCCGCGCGGCTGCGGAGGCAGACGGGCGATCCCAGATGGTGGTGTCGGTACGACCAACGGAGAGTCTCGACTCTG
CAACTGCTTCGAGTGAACTTGAGCCGGCCTTTTATCCTGTTCGCCACAGAGCCCATTCTGTGGTTCATGAATCTC
TGGATCTCCATCGCCTACAGCATCTTGTACTTCTGCTTCATAGCCTACCCTGTTGTCTTCTCCCAACATCGAGGA
TAG
Gene >Hirsu2|2036
ATGTCGGACGTAGTTCGTGCCCGCAGCCCTTCGGCGAGGCCGAGCCAGACGTCTGGAGAAGCAGCGGCAGCGATC
CAAGACGACCAAGATGAAGCCGACGCGACTCCCGAAAGCCTGCCCGTCGGGGCAGCACGCCCCACTCCCGCATCC
CTCCCTCACTCCGGGATTGCTGCCAGCATTGCCTCTCGCCTTCCCGATTTCGAAGTGATCCTGGAGGATGGCGAT
GCCGACAACCCCAAAAGCTGGCCGATCAGGTATCGCGGCTGGTGCATTGTGGCCGTCTCCCTTTCGACCTGGGTC
GTCACCCTTCTCAGCACCAGCTACAGTGCCTCGCTCACCGGCCTCGCCGACGAGTTTGGCGCCACGACGACCCTC
GTCGCGCTCGGCATGACCACCTATCTGCTCGGCCTAGCAGTCGGCACCCTTATTTTGGCCCCCATGGGCGAGCTC
TACGGCCGCCGCGTGGTCTACATCGTCTGCCTGTCCTCTTGGGCACTTTTGAATGTTCCTTGCGGCCTCGCCCAC
TCCTTGACGGCAATCATTGTCATCCGCTTCTTTGGGTGAGTGGCTCTTCTTTCCGGATCCCTATTCTCCGCGTTT
CCTCCTGAAATGCCGTGTCTGTACTCGGACTTCGTCTCGGTGTGATTCGGAGAGCGCCAAAAGCCATTCTAACCC
CCCTCCCACGCTCTTACCTGCCTCACACCCGTTTACGCCCTGTTTGACCGAGGGGAGATGGCAGGGCCTGTCTCG
GCGCCGTCACCATATCCAATGGCCCCGGCACTGTCGTCGACGTCTCACACCCCGAATACCTTGCCAGGGCTATGT
CGCTCTTCGGCTTCGCCCCATTCAACGGCCCCGTCACGGCACCCATCATCGGCGGCTTTGTCTTCCAGTACATGG
GATGGCGATGGGCCAACTGGATCGTCCTGATCATCGCGGGCGTCTGTATCGCTCTCGTACTGACGGTCGAAGAGA
CGTACGCGCCCACGATTTTGAAGCGCAAGGCCGCGCGGCTGCGGAGGCAGACGGGCGATCCCAGATGGTGGTGTC
GGTACGACCAACGGAGAGTCTCGACTCTGCAACTGCTTCGAGTGAACTTGAGCCGGCCTTTTATCCTGTTCGCCA
CAGAGCCCATTCTGTGGTTCATGAATCTCTGGTCAGTGACCTCCTTCTCCTCTGCGGGCACGCCTCCGTTTTGCC
TGCACTCTCCTCCCTTCCTCCCGTCCGACGTCGTTTCGTCAGCAAGACCAAGAGTGAAATGGTCCAGAGCCAAAA
TGAGTTGCTGAAAAGGGCAGTATCAGGATCTCCATCGCCTACAGCATCTTGTACTTCTGCTTCATAGCCTACCCT
GTTGTCTTCTCCCAACATCGAGGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail