Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2031
Gene name
LocationContig_1471:5275..6155
Strand+
Gene length (bp)880
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.789 0.4908 0.0306 0.048 0.1101 0.0041 0.0541 0.0618 0.1558 0.0302

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8962
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2031 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2031
MASQFIGLHMRVVLRDPPGYHLSGIVRDVEAGNSLSLTNVYMPATRERTAQMKIVASNIADLSEIVHDDMSPTSA
AAPEPVVAPAAPPPPAHHTFVDPAILSMGRRPASGTPSASGLLYHSDRAGRQKTESDPVPPAHPDSGQANRRSEQ
DLLDSIKGLRLDTPPRQQQHNNNGNNNGAHHADLRETPLQKKKARSRNTKQPRSQAGDQAAHAVDGSPAAIVQSA
HGKGWRQTPILESNST*
Coding >Hirsu2|2031
ATGGCGAGCCAGTTCATCGGACTGCACATGAGGGTCGTCCTCAGGGACCCGCCGGGCTATCACCTCAGCGGCATC
GTGAGAGATGTCGAGGCCGGCAACAGCCTCAGCTTGACAAATGTCTACATGCCCGCCACCCGGGAGCGGACGGCC
CAGATGAAGATCGTCGCCTCCAACATCGCAGACCTGTCGGAGATTGTCCACGACGACATGTCGCCTACGTCCGCC
GCCGCGCCAGAGCCGGTCGTCGCACCCGCCGCCCCGCCGCCGCCCGCGCACCACACCTTCGTCGATCCCGCCATC
CTGAGCATGGGCAGACGTCCCGCCTCCGGCACCCCGTCCGCCTCGGGCCTGCTCTACCACTCCGACCGCGCCGGC
CGGCAGAAGACGGAGTCGGACCCCGTGCCGCCCGCGCACCCAGACTCGGGCCAGGCGAACAGGCGGTCCGAGCAG
GACCTGCTGGACTCGATCAAGGGCCTCAGGCTCGACACGCCGCCGCGGCAGCAGCAGCACAACAACAACGGCAAT
AACAACGGTGCCCATCACGCCGACCTGCGCGAAACGCCGCTGCAGAAGAAGAAGGCGCGCTCTCGGAACACGAAG
CAGCCGAGGAGCCAGGCCGGCGACCAGGCCGCCCACGCCGTCGACGGCTCCCCCGCCGCCATCGTCCAGAGCGCC
CACGGCAAGGGCTGGAGGCAGACGCCCATCCTCGAGAGCAACTCGACGTGA
Transcript >Hirsu2|2031
ATGGCGAGCCAGTTCATCGGACTGCACATGAGGGTCGTCCTCAGGGACCCGCCGGGCTATCACCTCAGCGGCATC
GTGAGAGATGTCGAGGCCGGCAACAGCCTCAGCTTGACAAATGTCTACATGCCCGCCACCCGGGAGCGGACGGCC
CAGATGAAGATCGTCGCCTCCAACATCGCAGACCTGTCGGAGATTGTCCACGACGACATGTCGCCTACGTCCGCC
GCCGCGCCAGAGCCGGTCGTCGCACCCGCCGCCCCGCCGCCGCCCGCGCACCACACCTTCGTCGATCCCGCCATC
CTGAGCATGGGCAGACGTCCCGCCTCCGGCACCCCGTCCGCCTCGGGCCTGCTCTACCACTCCGACCGCGCCGGC
CGGCAGAAGACGGAGTCGGACCCCGTGCCGCCCGCGCACCCAGACTCGGGCCAGGCGAACAGGCGGTCCGAGCAG
GACCTGCTGGACTCGATCAAGGGCCTCAGGCTCGACACGCCGCCGCGGCAGCAGCAGCACAACAACAACGGCAAT
AACAACGGTGCCCATCACGCCGACCTGCGCGAAACGCCGCTGCAGAAGAAGAAGGCGCGCTCTCGGAACACGAAG
CAGCCGAGGAGCCAGGCCGGCGACCAGGCCGCCCACGCCGTCGACGGCTCCCCCGCCGCCATCGTCCAGAGCGCC
CACGGCAAGGGCTGGAGGCAGACGCCCATCCTCGAGAGCAACTCGACGTGA
Gene >Hirsu2|2031
ATGGCGAGCCAGTTCATCGGACTGCACATGAGGGTCGTCCTCAGGGACCCGCCGGGCTATCACCTCAGCGGCATC
GTGAGAGATGTCGAGGCCGGCAACAGCCTCAGCTTGACAAATGGTATGCCCCATTTCTGTCGCGGCCCCGAGAGC
CGTGTTCGCTGACTGGCGCCTCCCTCTTCCCTCACAGTCTACATGCCCGCCACCCGGGAGCGGACGGCCCAGATG
AAGATCGTCGCCTCCAACATCGCAGACCTGTCGGAGATTGTCCACGACGACATGTCGCCTACGTCCGCCGCCGCG
CCAGAGCCGGTCGTCGCACCCGCCGCCCCGCCGCCGCCCGCGCACCACACCTTCGTCGATCCCGCCATCCTGAGC
ATGGGCAGACGTCCCGCCTCCGGCACCCCGTCCGCCTCGGGCCTGCTCTACCACTCCGACCGCGCCGGCCGGCAG
AAGACGGAGTCGGACCCCGTGCCGCCCGCGCACCCAGACTCGGGCCAGGCGAACAGGCGGTCCGAGCAGGACCTG
CTGGACTCGATCAAGGGCCTCAGGCTCGACACGCCGCCGCGGCAGCAGCAGCACAACAACAACGGCAATAACAAC
GGTGCCCATCACGCCGACCTGCGCGAAACGCCGCTGCAGAAGAAGAAGGCGCGCTCTCGGAACACGAAGCAGCCG
AGGAGCCAGGCCGGCGACCAGGCCGCCCACGCCGTCGACGGCTCCCCCGCCGCCATCGTCCAGAGCGCCCACGGC
AAGGGCTGGAGGCAGACGCCCATCCTCGAGAGCAACTCGTCCTTCCAGCCCTTCAACTCGCTCAAGCGCCAGCGC
AAGGGCCGCCGCGGCGCCGCCCACGACAACAACGGCTGGGCCTCGGAGGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail