Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2025
Gene name
LocationContig_147:22953..24060
Strand-
Gene length (bp)1107
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 24 317 7.0E-87
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 1 317 1.0E-79
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 24 315 4.0E-77
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 26 315 7.0E-77
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 24 315 8.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 24 317 7.0E-87
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 1 317 1.0E-79
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 24 315 4.0E-77
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 26 315 7.0E-77
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 24 315 8.0E-77
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 24 315 8.0E-77
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 24 317 4.0E-75
sp|A1CD22|EGLC_ASPCL Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglC PE=3 SV=1 24 315 1.0E-74
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 25 275 2.0E-15
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 15 275 1.0E-13
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 8 275 2.0E-13
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 8 275 3.0E-13
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 2 287 1.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 345 367 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2025
MLLLKSALVASCLVSSGLAAANDYIGFNSGARKDDNSIKEEKDYRDEFLAAKSLPGTDGKFTAVRLFTCLKPESK
DELLPAFAAAVETNTSMLLGIWTSGTKSIDNEIKGLKRAIEKWGDKFTKLVVGMSIGSEDLYRASEDGVKNKAGI
GNSVENIIGFVEKYRKEMNDTPLARVPVGHVDVWKVWRNQSNKALADTLDFVGLDAYAYYENDLDNTITNASALF
DMSFNATRGTVGADKPIWITEIGWPSSGPDWGKGVSSVKNAKYFWDEVGCRKLFNKMPTFWYILRDSNPDNKMKF
AVAEKGNLNKPVFDLSCPAGSDSGFDSNAAARSGPPDVDIRGAAALPSAPAGILYTTLFLVVGLLAWA*
Coding >Hirsu2|2025
ATGCTGCTGCTCAAGTCTGCTCTGGTGGCCAGCTGCCTCGTCAGCAGCGGGCTGGCCGCGGCCAACGACTACATC
GGCTTCAACTCGGGCGCCCGCAAGGACGATAACTCGATCAAGGAGGAGAAGGACTACAGAGACGAGTTCCTGGCG
GCCAAGTCTCTGCCCGGGACGGACGGAAAGTTCACCGCCGTCCGGCTCTTCACCTGCCTCAAGCCCGAGAGCAAG
GACGAGCTCCTGCCGGCCTTCGCCGCGGCTGTTGAGACCAACACGTCTATGCTGCTGGGCATATGGACCTCGGGA
ACGAAGAGCATCGACAACGAAATCAAGGGCCTTAAGAGGGCCATCGAGAAATGGGGCGACAAGTTTACCAAGCTC
GTTGTCGGCATGTCCATCGGCAGCGAGGACCTGTACCGCGCTTCCGAGGACGGCGTCAAGAATAAGGCGGGCATC
GGCAACTCCGTTGAGAACATCATCGGCTTCGTCGAAAAGTACCGCAAGGAGATGAACGACACGCCTCTGGCCAGG
GTGCCCGTCGGCCACGTCGACGTCTGGAAGGTATGGCGCAACCAGTCCAACAAGGCGCTCGCCGACACCCTCGAC
TTCGTCGGCCTCGATGCCTACGCCTACTACGAGAACGACCTGGACAACACCATCACCAACGCCTCCGCCCTGTTC
GACATGTCCTTTAACGCGACCCGGGGCACGGTCGGGGCCGACAAGCCCATCTGGATCACCGAGATCGGCTGGCCC
TCCAGCGGCCCGGACTGGGGCAAGGGCGTGTCGAGCGTCAAGAACGCCAAGTACTTCTGGGACGAGGTCGGCTGC
CGCAAGCTGTTCAACAAGATGCCGACCTTCTGGTACATCCTGCGCGACTCCAACCCGGACAACAAGATGAAGTTT
GCCGTCGCCGAGAAGGGCAACCTCAACAAGCCCGTCTTCGACCTCAGCTGCCCGGCCGGCTCCGACTCCGGATTC
GACTCCAACGCGGCGGCCAGGTCCGGGCCGCCCGACGTCGACATCCGTGGTGCCGCGGCCCTGCCGTCTGCGCCC
GCCGGCATCCTGTACACCACCCTGTTCCTGGTCGTCGGTCTCTTGGCTTGGGCCTAG
Transcript >Hirsu2|2025
ATGCTGCTGCTCAAGTCTGCTCTGGTGGCCAGCTGCCTCGTCAGCAGCGGGCTGGCCGCGGCCAACGACTACATC
GGCTTCAACTCGGGCGCCCGCAAGGACGATAACTCGATCAAGGAGGAGAAGGACTACAGAGACGAGTTCCTGGCG
GCCAAGTCTCTGCCCGGGACGGACGGAAAGTTCACCGCCGTCCGGCTCTTCACCTGCCTCAAGCCCGAGAGCAAG
GACGAGCTCCTGCCGGCCTTCGCCGCGGCTGTTGAGACCAACACGTCTATGCTGCTGGGCATATGGACCTCGGGA
ACGAAGAGCATCGACAACGAAATCAAGGGCCTTAAGAGGGCCATCGAGAAATGGGGCGACAAGTTTACCAAGCTC
GTTGTCGGCATGTCCATCGGCAGCGAGGACCTGTACCGCGCTTCCGAGGACGGCGTCAAGAATAAGGCGGGCATC
GGCAACTCCGTTGAGAACATCATCGGCTTCGTCGAAAAGTACCGCAAGGAGATGAACGACACGCCTCTGGCCAGG
GTGCCCGTCGGCCACGTCGACGTCTGGAAGGTATGGCGCAACCAGTCCAACAAGGCGCTCGCCGACACCCTCGAC
TTCGTCGGCCTCGATGCCTACGCCTACTACGAGAACGACCTGGACAACACCATCACCAACGCCTCCGCCCTGTTC
GACATGTCCTTTAACGCGACCCGGGGCACGGTCGGGGCCGACAAGCCCATCTGGATCACCGAGATCGGCTGGCCC
TCCAGCGGCCCGGACTGGGGCAAGGGCGTGTCGAGCGTCAAGAACGCCAAGTACTTCTGGGACGAGGTCGGCTGC
CGCAAGCTGTTCAACAAGATGCCGACCTTCTGGTACATCCTGCGCGACTCCAACCCGGACAACAAGATGAAGTTT
GCCGTCGCCGAGAAGGGCAACCTCAACAAGCCCGTCTTCGACCTCAGCTGCCCGGCCGGCTCCGACTCCGGATTC
GACTCCAACGCGGCGGCCAGGTCCGGGCCGCCCGACGTCGACATCCGTGGTGCCGCGGCCCTGCCGTCTGCGCCC
GCCGGCATCCTGTACACCACCCTGTTCCTGGTCGTCGGTCTCTTGGCTTGGGCCTAG
Gene >Hirsu2|2025
ATGCTGCTGCTCAAGTCTGCTCTGGTGGCCAGCTGCCTCGTCAGCAGCGGGCTGGCCGCGGCCAACGACTACATC
GGCTTCAACTCGGGCGCCCGCAAGGACGATAACTCGATCAAGGAGGAGAAGGACTACAGAGACGAGTTCCTGGCG
GCCAAGTCTCTGCCCGGGACGGACGGAAAGTTCACCGCCGTCCGGCTCTTCACCTGCCTCAAGCCCGAGAGCAAG
GACGAGCTCCTGCCGGCCTTCGCCGCGGCTGTTGAGACCAACACGTCTATGCTGCTGGGCATATGGACCTCGGGA
ACGAAGAGCATCGACAACGAAATCAAGGGCCTTAAGAGGGCCATCGAGAAATGGGGCGACAAGTTTACCAAGCTC
GTTGTCGGCATGTCCATCGGCAGCGAGGACCTGTACCGCGCTTCCGAGGACGGCGTCAAGAATAAGGCGGGCATC
GGCAACTCCGTTGAGAACATCATCGGCTTCGTCGAAAAGTACCGCAAGGAGATGAACGACACGCCTCTGGCCAGG
GTGCCCGTCGGCCACGTCGACGTCTGGAAGGTATGGCGCAACCAGTCCAACAAGGCGCTCGCCGACACCCTCGAC
TTCGTCGGCCTCGATGCCTACGCCTACTACGAGAACGACCTGGACAACACCATCACCAACGCCTCCGCCCTGTTC
GACATGTCCTTTAACGCGACCCGGGGCACGGTCGGGGCCGACAAGCCCATCTGGATCACCGAGATCGGCTGGCCC
TCCAGCGGCCCGGACTGGGGCAAGGGCGTGTCGAGCGTCAAGAACGCCAAGTACTTCTGGGACGAGGTCGGCTGC
CGCAAGCTGTTCAACAAGATGCCGACCTTCTGGTACATCCTGCGCGACTCCAACCCGGACAACAAGATGAAGTTT
GCCGTCGCCGAGAAGGGCAACCTCAACAAGCCCGTCTTCGACCTCAGCTGCCCGGCCGGCTCCGACTCCGGATTC
GACTCCAACGCGGCGGCCAGGTCCGGGCCGCCCGACGTCGACATCCGTGGTGCCGCGGCCCTGCCGTCTGCGCCC
GCCGGCATCCTGTACACCACCCTGTTCCTGGTCGTCGGTCTCTTGGCTTGGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail