Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2020
Gene name
LocationContig_147:8339..12262
Strand-
Gene length (bp)3923
Transcript length (bp)3828
Coding sequence length (bp)3828
Protein length (aa) 1276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08148 DSHCT DSHCT (NUC185) domain 2.2E-50 1099 1268
PF17911 Ski2_N Ski2 N-terminal region 5.0E-38 48 195
PF13234 rRNA_proc-arch rRNA-processing arch domain 5.9E-30 807 1071
PF00270 DEAD DEAD/DEAH box helicase 6.5E-17 301 447
PF00271 Helicase_C Helicase conserved C-terminal domain 5.0E-06 663 749

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 35 1275 0.0E+00
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 31 1275 0.0E+00
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 28 1275 0.0E+00
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 28 1274 0.0E+00
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 291 1275 6.0E-178
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 35 1275 0.0E+00
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 31 1275 0.0E+00
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 28 1275 0.0E+00
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 28 1274 0.0E+00
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 291 1275 6.0E-178
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 291 1275 8.0E-178
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 291 1275 2.0E-177
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 291 1275 8.0E-177
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 282 1275 1.0E-168
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 598 1275 2.0E-91
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 293 817 2.0E-80
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 293 817 2.0E-80
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 293 817 1.0E-78
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 294 867 3.0E-76
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 251 514 1.0E-68
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 289 516 4.0E-66
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 291 507 1.0E-65
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 598 825 1.0E-51
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 609 856 8.0E-50
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 1059 1275 3.0E-29
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 1084 1275 4.0E-26
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 309 479 2.0E-17
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 309 485 2.0E-17
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 312 474 3.0E-17
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 302 474 5.0E-17
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 622 799 6.0E-17
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 302 474 7.0E-17
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 302 474 2.0E-16
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 311 474 4.0E-16
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 302 476 4.0E-16
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 240 478 7.0E-16
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 296 475 9.0E-16
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 280 485 1.0E-15
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 315 491 1.0E-15
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 312 474 2.0E-15
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 296 481 2.0E-15
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 644 815 4.0E-15
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 665 759 7.0E-15
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 664 788 9.0E-15
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 296 517 1.0E-14
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 665 835 2.0E-14
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 302 474 2.0E-14
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 313 485 4.0E-14
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 610 835 5.0E-14
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 297 501 5.0E-14
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 302 498 5.0E-14
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 311 521 6.0E-14
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 312 474 6.0E-14
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 610 835 8.0E-14
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 612 762 1.0E-13
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 281 474 1.0E-13
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 657 821 2.0E-13
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 296 477 4.0E-13
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 602 759 4.0E-13
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 240 508 4.0E-13
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 302 474 4.0E-13
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 665 759 6.0E-13
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 664 788 1.0E-12
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 630 799 1.0E-12
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 615 759 1.0E-12
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 302 485 1.0E-12
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 302 485 1.0E-12
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 280 491 1.0E-12
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 289 475 1.0E-12
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 663 759 1.0E-12
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 672 759 2.0E-12
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 302 454 2.0E-12
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 669 798 3.0E-12
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 292 474 3.0E-12
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 612 759 3.0E-12
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 665 826 4.0E-12
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 610 759 4.0E-12
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 612 754 5.0E-12
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 309 487 6.0E-12
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 314 455 1.0E-11
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 296 474 2.0E-11
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 612 759 2.0E-11
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 292 475 2.0E-11
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 672 759 3.0E-11
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 612 759 3.0E-11
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 612 759 3.0E-11
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 612 763 3.0E-11
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 612 763 3.0E-11
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 612 763 3.0E-11
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 665 759 4.0E-11
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 612 801 4.0E-11
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 593 788 5.0E-11
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 612 759 5.0E-11
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 294 525 6.0E-11
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 665 821 1.0E-10
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 612 759 1.0E-10
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 612 759 1.0E-10
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 609 759 2.0E-10
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 313 476 2.0E-10
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 610 759 2.0E-10
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 611 814 3.0E-10
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 305 478 3.0E-10
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 611 759 4.0E-10
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 611 759 4.0E-10
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 665 759 4.0E-10
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 664 759 4.0E-10
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 664 759 6.0E-10
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 638 759 7.0E-10
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 281 485 9.0E-10
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 664 759 9.0E-10
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 611 788 1.0E-09
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 304 474 1.0E-09
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 664 759 1.0E-09
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 293 484 1.0E-09
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 293 484 1.0E-09
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 293 484 1.0E-09
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 609 759 1.0E-09
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 149 479 1.0E-09
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 664 759 1.0E-09
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 610 794 2.0E-09
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 645 759 2.0E-09
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 610 817 3.0E-09
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 304 516 3.0E-09
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 309 476 4.0E-09
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 314 454 4.0E-09
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 279 478 5.0E-09
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 309 476 6.0E-09
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 309 476 6.0E-09
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 310 491 6.0E-09
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 597 759 6.0E-09
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 611 754 7.0E-09
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 665 758 8.0E-09
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 663 759 8.0E-09
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 281 478 8.0E-09
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 296 477 1.0E-08
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 296 487 1.0E-08
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 281 478 1.0E-08
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 665 759 1.0E-08
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 665 759 1.0E-08
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 665 759 1.0E-08
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 665 759 1.0E-08
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 299 458 2.0E-08
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 652 759 2.0E-08
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 295 475 2.0E-08
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 295 475 2.0E-08
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 295 475 2.0E-08
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 295 475 2.0E-08
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 598 759 3.0E-08
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 297 485 3.0E-08
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 309 474 4.0E-08
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 665 759 4.0E-08
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 309 476 5.0E-08
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 309 476 5.0E-08
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 314 474 7.0E-08
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 664 759 9.0E-08
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 664 759 1.0E-07
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 599 759 1.0E-07
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 298 474 2.0E-07
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 567 754 2.0E-07
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 607 759 2.0E-07
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 309 486 3.0E-07
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 598 759 3.0E-07
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 612 759 6.0E-07
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 665 822 1.0E-06
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 281 476 2.0E-06
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 312 495 4.0E-06
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 299 459 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2020
MAGIDALLLSQDQGEGAGRQSRDLDEAKRQLEERFLLPSAAFSTEWLNRLQQRWDFEADYPSLFKIAPPQTRTVT
RFLRRGLEGRVTGYENVTVPVSSATAKNSTSLLRKPASRAEFVRGAAGFFPFAPGGLDGIEATAALEDQVHAGGT
AGDAAPGANKLDRVIQLGTQGGLLEVAPGLERGIDFSKRKSPADDEDANVIEQVLQEDPEDAGSAGVDDGGVSPR
EPAPDATNGDEDGDDIDDILPVEFPSLEPHGVLAASSARKAGREWAHMVDIRHGMPNFRELVPDMAREWPFELDT
FQKEAVYHLENGDSVFVAAHTSAGKTVVAEYAIALASKHMTKAIYTSPIKALSNQKFRDFRNDFSDVGILTGDVQ
INPEASCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDFERGVVWEEVIIMLPEHVSLILLSATVPNTYEF
ASWVGRTKQKDIYVISTSKRPVPLEHYLWAGKNIHRIVDADKKFVDNGWKDAHSASQRKDKPKAADNSMAVRGGN
PRGGQRGGPQRGGHQQQRGGGRGAGGGHQRGGGAQRGRGGPPRASYTPGHMGRAGRPGGMSSAAQDKNLWVHLVQ
FLRKQSLLPACIFVFSKKRCEENADALSNQDFCTATEKSHIHMIIEKSVARLKPEDRVLPQIVRLRELLGRGIAV
HHGGLLPIVKELVEILFAQTLVKVLFATETFAMGLNLPTRTVVFSGYRKHDGHSFRNLLPGEYTQMAGRAGRRGL
DTVGSVIIVPPGGSDDVPPVAELRNMILGEPSKLRSQFRLTYNMILNLLRVEALKIEEMIKRSFSEHATQQLLPE
HEKDVKLAQADLAKVKREPCKTCDTAMDECHQAAQDYKQLTLELYKGLLRITIGRKMFMPQRLVVFSWEGIRTVG
LLVSEGMSPRGSLDEPILQVCAVKPLRERRDASDQLPFIPAFRRYLHKLPQGKRRMQVRMLHVPLSDVECVTRWV
VKGTIPDIFTHGPPGYQAIDRMQEVCYAWDDRWDEADMGKIKSLQLQEIVEKRTQLVKLMSLSPAARCPSFLKHF
AMCHDEWLIKEHISQLKQSLSDQNLQLLPDYEQRVQVLKELGFVDDATRIQLKGKVACEVHSGDELVLTELILDN
VLADFEPAEIAALLSSFVFQEKTLVEPTLTGNLSRGRDTIVAISEKVNDVQTRLQVIQSSDESNDFVSRPRFGLM
EVVYEWARGMSFKNITALTDVLEGTIVRTITRLDETCREVKNAARIVGDPELYQKMQQAQELIKRDITAVASLYM
*
Coding >Hirsu2|2020
ATGGCCGGCATCGACGCCCTCCTGCTCTCTCAGGACCAGGGCGAGGGCGCCGGGCGCCAGTCCCGAGATCTGGAC
GAGGCCAAGCGCCAGCTCGAGGAACGCTTCCTGCTGCCGTCGGCCGCCTTCTCGACCGAATGGCTCAATCGCCTG
CAGCAGCGCTGGGACTTCGAGGCCGACTACCCTTCGCTCTTCAAGATTGCCCCCCCGCAGACTCGCACAGTCACC
CGCTTCCTGCGCCGAGGCCTCGAGGGCAGGGTGACCGGCTACGAGAACGTGACGGTGCCGGTCAGCAGTGCCACG
GCCAAGAACTCGACCAGCCTGCTGCGGAAGCCCGCGAGCCGGGCCGAATTCGTCAGGGGAGCTGCCGGCTTCTTC
CCCTTTGCCCCGGGCGGCCTGGACGGTATCGAGGCGACGGCTGCTCTCGAGGACCAGGTCCATGCCGGCGGGACG
GCCGGCGACGCTGCACCTGGTGCCAACAAGCTCGACAGGGTCATTCAGCTCGGCACCCAAGGAGGCTTGCTCGAG
GTCGCCCCCGGTCTGGAGCGCGGCATCGACTTCAGCAAGCGGAAGTCTCCCGCAGACGACGAGGACGCCAACGTC
ATCGAGCAAGTGCTTCAAGAGGATCCGGAAGACGCAGGCAGCGCAGGAGTGGATGACGGCGGCGTCTCGCCCCGT
GAGCCCGCGCCGGACGCCACCAACGGCGACGAGGACGGCGACGACATCGACGACATCCTGCCAGTCGAGTTCCCT
TCGCTCGAGCCCCATGGCGTCCTTGCTGCGTCCAGTGCTAGGAAGGCTGGCCGCGAGTGGGCGCACATGGTCGAC
ATCAGGCACGGCATGCCCAACTTCCGCGAGCTCGTGCCTGATATGGCTCGCGAGTGGCCCTTCGAGCTCGACACC
TTCCAGAAGGAAGCCGTCTACCATCTGGAGAACGGAGACTCGGTCTTTGTCGCGGCGCACACCTCGGCCGGCAAG
ACTGTCGTAGCCGAATATGCCATCGCGCTGGCGTCCAAGCACATGACCAAGGCCATCTATACGTCCCCGATCAAG
GCCCTCAGCAACCAGAAGTTCCGCGACTTTAGAAACGACTTCAGCGACGTCGGCATCTTAACCGGCGACGTTCAG
ATTAATCCCGAGGCCAGCTGTCTCATTATGACGACGGAGATCCTGCGGAGTATGCTATATAGGGGAGCCGACCTG
ATTCGAGACGTCGAGTTCGTCATCTTCGACGAGGTGCACTACGTCAACGACTTCGAGCGAGGCGTCGTCTGGGAA
GAGGTCATCATCATGCTGCCCGAGCATGTCTCTCTCATCCTCCTCTCGGCCACCGTTCCCAATACGTACGAATTT
GCGTCGTGGGTAGGCCGCACCAAACAGAAGGACATATACGTCATCTCAACGTCCAAGCGGCCCGTCCCTCTGGAG
CACTATCTCTGGGCCGGCAAGAACATCCATCGGATTGTCGATGCTGACAAGAAATTTGTCGATAACGGGTGGAAG
GACGCCCACTCCGCCTCCCAACGCAAAGACAAGCCCAAGGCAGCCGATAACTCCATGGCCGTGCGTGGCGGCAAT
CCTCGTGGCGGCCAGCGCGGCGGCCCTCAGAGGGGCGGCCATCAGCAGCAACGCGGTGGAGGCCGAGGAGCTGGC
GGCGGTCATCAGCGCGGCGGCGGCGCGCAAAGGGGGCGCGGAGGCCCTCCCCGTGCCAGTTACACCCCCGGCCAC
ATGGGTCGGGCTGGGCGCCCCGGGGGCATGTCGTCGGCAGCCCAGGACAAGAACCTCTGGGTCCATCTCGTCCAG
TTCCTCCGCAAGCAGAGCCTGCTGCCGGCATGCATCTTCGTCTTCTCCAAGAAACGGTGCGAAGAGAATGCGGAC
GCGTTGAGCAACCAGGACTTTTGCACAGCAACTGAGAAGAGCCACATCCACATGATCATCGAAAAGTCGGTCGCG
CGGCTGAAGCCCGAGGACAGGGTCTTGCCCCAGATCGTCAGGCTCAGGGAGCTGCTGGGCCGCGGCATCGCCGTT
CATCACGGGGGCCTGCTACCGATCGTGAAGGAACTGGTGGAGATTCTGTTTGCCCAGACGTTGGTCAAAGTTCTC
TTCGCCACAGAGACGTTTGCCATGGGGCTCAACCTGCCGACGCGAACCGTCGTCTTTTCCGGCTACCGCAAGCAT
GACGGGCACTCGTTCCGGAACCTGCTCCCTGGCGAGTACACGCAGATGGCGGGCCGAGCTGGCCGCCGCGGCCTC
GACACCGTCGGCTCCGTCATCATCGTGCCCCCTGGTGGCTCGGATGACGTACCTCCCGTGGCGGAGCTGCGGAAC
ATGATCCTCGGCGAGCCGTCCAAGCTCCGATCGCAGTTCCGCTTGACGTACAACATGATTCTCAACCTGCTACGT
GTCGAGGCGCTCAAGATTGAAGAGATGATCAAGCGCAGCTTCTCCGAACACGCCACCCAGCAGCTGCTCCCCGAG
CACGAAAAGGACGTCAAGCTGGCGCAGGCCGATCTGGCCAAGGTCAAGCGGGAGCCGTGCAAGACGTGCGACACC
GCCATGGACGAGTGCCACCAAGCCGCCCAGGATTACAAGCAACTCACGCTCGAGCTCTACAAGGGGCTGCTCAGA
ATCACCATCGGGCGCAAGATGTTCATGCCTCAGCGGCTCGTCGTCTTCAGCTGGGAAGGCATCCGCACCGTCGGC
CTGCTCGTCTCCGAGGGCATGAGCCCCAGGGGCTCTTTGGACGAGCCCATCTTGCAGGTCTGCGCCGTCAAGCCC
CTCCGCGAGCGGCGCGACGCCTCGGATCAGCTCCCCTTCATTCCCGCGTTCCGCAGGTACCTGCACAAGCTGCCC
CAAGGCAAGCGACGGATGCAGGTGAGGATGCTGCACGTGCCCCTCAGCGACGTCGAGTGCGTCACGCGATGGGTG
GTCAAGGGCACTATTCCCGACATCTTCACGCACGGCCCACCGGGATACCAGGCCATAGACCGAATGCAGGAGGTT
TGCTATGCTTGGGACGACAGGTGGGATGAGGCCGACATGGGCAAGATCAAGAGCCTACAGCTTCAGGAGATTGTG
GAGAAGAGGACGCAGCTCGTCAAGCTGATGTCGCTCTCGCCCGCAGCGCGGTGTCCTTCCTTTTTAAAGCATTTT
GCCATGTGCCACGACGAATGGCTCATCAAGGAGCATATTTCGCAGCTCAAGCAATCTCTCTCGGACCAGAACCTC
CAGCTGCTGCCCGACTACGAGCAGCGCGTCCAGGTGCTCAAGGAGCTTGGCTTCGTCGACGACGCCACGCGGATC
CAGCTCAAGGGCAAGGTGGCCTGCGAGGTGCACTCGGGCGACGAGCTGGTCCTGACGGAACTCATCCTCGACAAC
GTGCTCGCCGACTTCGAGCCGGCCGAGATTGCGGCCCTCCTGTCGTCGTTTGTGTTCCAGGAGAAGACGCTGGTG
GAGCCGACGCTCACGGGGAACCTCTCGCGCGGACGCGACACGATCGTAGCCATCTCGGAAAAGGTCAACGACGTG
CAGACGCGGCTGCAGGTGATCCAGTCGTCGGACGAGTCCAACGACTTCGTGTCGCGGCCGCGGTTCGGACTGATG
GAGGTGGTGTACGAGTGGGCGCGCGGCATGAGCTTCAAGAACATCACGGCGCTGACGGACGTGCTCGAGGGGACC
ATCGTCCGGACCATCACGCGGCTGGACGAGACGTGTCGGGAGGTGAAGAACGCGGCGCGCATCGTGGGCGACCCG
GAGCTGTACCAGAAGATGCAGCAAGCGCAGGAGCTGATCAAGAGGGACATTACCGCGGTCGCGAGCCTGTACATG
TGA
Transcript >Hirsu2|2020
ATGGCCGGCATCGACGCCCTCCTGCTCTCTCAGGACCAGGGCGAGGGCGCCGGGCGCCAGTCCCGAGATCTGGAC
GAGGCCAAGCGCCAGCTCGAGGAACGCTTCCTGCTGCCGTCGGCCGCCTTCTCGACCGAATGGCTCAATCGCCTG
CAGCAGCGCTGGGACTTCGAGGCCGACTACCCTTCGCTCTTCAAGATTGCCCCCCCGCAGACTCGCACAGTCACC
CGCTTCCTGCGCCGAGGCCTCGAGGGCAGGGTGACCGGCTACGAGAACGTGACGGTGCCGGTCAGCAGTGCCACG
GCCAAGAACTCGACCAGCCTGCTGCGGAAGCCCGCGAGCCGGGCCGAATTCGTCAGGGGAGCTGCCGGCTTCTTC
CCCTTTGCCCCGGGCGGCCTGGACGGTATCGAGGCGACGGCTGCTCTCGAGGACCAGGTCCATGCCGGCGGGACG
GCCGGCGACGCTGCACCTGGTGCCAACAAGCTCGACAGGGTCATTCAGCTCGGCACCCAAGGAGGCTTGCTCGAG
GTCGCCCCCGGTCTGGAGCGCGGCATCGACTTCAGCAAGCGGAAGTCTCCCGCAGACGACGAGGACGCCAACGTC
ATCGAGCAAGTGCTTCAAGAGGATCCGGAAGACGCAGGCAGCGCAGGAGTGGATGACGGCGGCGTCTCGCCCCGT
GAGCCCGCGCCGGACGCCACCAACGGCGACGAGGACGGCGACGACATCGACGACATCCTGCCAGTCGAGTTCCCT
TCGCTCGAGCCCCATGGCGTCCTTGCTGCGTCCAGTGCTAGGAAGGCTGGCCGCGAGTGGGCGCACATGGTCGAC
ATCAGGCACGGCATGCCCAACTTCCGCGAGCTCGTGCCTGATATGGCTCGCGAGTGGCCCTTCGAGCTCGACACC
TTCCAGAAGGAAGCCGTCTACCATCTGGAGAACGGAGACTCGGTCTTTGTCGCGGCGCACACCTCGGCCGGCAAG
ACTGTCGTAGCCGAATATGCCATCGCGCTGGCGTCCAAGCACATGACCAAGGCCATCTATACGTCCCCGATCAAG
GCCCTCAGCAACCAGAAGTTCCGCGACTTTAGAAACGACTTCAGCGACGTCGGCATCTTAACCGGCGACGTTCAG
ATTAATCCCGAGGCCAGCTGTCTCATTATGACGACGGAGATCCTGCGGAGTATGCTATATAGGGGAGCCGACCTG
ATTCGAGACGTCGAGTTCGTCATCTTCGACGAGGTGCACTACGTCAACGACTTCGAGCGAGGCGTCGTCTGGGAA
GAGGTCATCATCATGCTGCCCGAGCATGTCTCTCTCATCCTCCTCTCGGCCACCGTTCCCAATACGTACGAATTT
GCGTCGTGGGTAGGCCGCACCAAACAGAAGGACATATACGTCATCTCAACGTCCAAGCGGCCCGTCCCTCTGGAG
CACTATCTCTGGGCCGGCAAGAACATCCATCGGATTGTCGATGCTGACAAGAAATTTGTCGATAACGGGTGGAAG
GACGCCCACTCCGCCTCCCAACGCAAAGACAAGCCCAAGGCAGCCGATAACTCCATGGCCGTGCGTGGCGGCAAT
CCTCGTGGCGGCCAGCGCGGCGGCCCTCAGAGGGGCGGCCATCAGCAGCAACGCGGTGGAGGCCGAGGAGCTGGC
GGCGGTCATCAGCGCGGCGGCGGCGCGCAAAGGGGGCGCGGAGGCCCTCCCCGTGCCAGTTACACCCCCGGCCAC
ATGGGTCGGGCTGGGCGCCCCGGGGGCATGTCGTCGGCAGCCCAGGACAAGAACCTCTGGGTCCATCTCGTCCAG
TTCCTCCGCAAGCAGAGCCTGCTGCCGGCATGCATCTTCGTCTTCTCCAAGAAACGGTGCGAAGAGAATGCGGAC
GCGTTGAGCAACCAGGACTTTTGCACAGCAACTGAGAAGAGCCACATCCACATGATCATCGAAAAGTCGGTCGCG
CGGCTGAAGCCCGAGGACAGGGTCTTGCCCCAGATCGTCAGGCTCAGGGAGCTGCTGGGCCGCGGCATCGCCGTT
CATCACGGGGGCCTGCTACCGATCGTGAAGGAACTGGTGGAGATTCTGTTTGCCCAGACGTTGGTCAAAGTTCTC
TTCGCCACAGAGACGTTTGCCATGGGGCTCAACCTGCCGACGCGAACCGTCGTCTTTTCCGGCTACCGCAAGCAT
GACGGGCACTCGTTCCGGAACCTGCTCCCTGGCGAGTACACGCAGATGGCGGGCCGAGCTGGCCGCCGCGGCCTC
GACACCGTCGGCTCCGTCATCATCGTGCCCCCTGGTGGCTCGGATGACGTACCTCCCGTGGCGGAGCTGCGGAAC
ATGATCCTCGGCGAGCCGTCCAAGCTCCGATCGCAGTTCCGCTTGACGTACAACATGATTCTCAACCTGCTACGT
GTCGAGGCGCTCAAGATTGAAGAGATGATCAAGCGCAGCTTCTCCGAACACGCCACCCAGCAGCTGCTCCCCGAG
CACGAAAAGGACGTCAAGCTGGCGCAGGCCGATCTGGCCAAGGTCAAGCGGGAGCCGTGCAAGACGTGCGACACC
GCCATGGACGAGTGCCACCAAGCCGCCCAGGATTACAAGCAACTCACGCTCGAGCTCTACAAGGGGCTGCTCAGA
ATCACCATCGGGCGCAAGATGTTCATGCCTCAGCGGCTCGTCGTCTTCAGCTGGGAAGGCATCCGCACCGTCGGC
CTGCTCGTCTCCGAGGGCATGAGCCCCAGGGGCTCTTTGGACGAGCCCATCTTGCAGGTCTGCGCCGTCAAGCCC
CTCCGCGAGCGGCGCGACGCCTCGGATCAGCTCCCCTTCATTCCCGCGTTCCGCAGGTACCTGCACAAGCTGCCC
CAAGGCAAGCGACGGATGCAGGTGAGGATGCTGCACGTGCCCCTCAGCGACGTCGAGTGCGTCACGCGATGGGTG
GTCAAGGGCACTATTCCCGACATCTTCACGCACGGCCCACCGGGATACCAGGCCATAGACCGAATGCAGGAGGTT
TGCTATGCTTGGGACGACAGGTGGGATGAGGCCGACATGGGCAAGATCAAGAGCCTACAGCTTCAGGAGATTGTG
GAGAAGAGGACGCAGCTCGTCAAGCTGATGTCGCTCTCGCCCGCAGCGCGGTGTCCTTCCTTTTTAAAGCATTTT
GCCATGTGCCACGACGAATGGCTCATCAAGGAGCATATTTCGCAGCTCAAGCAATCTCTCTCGGACCAGAACCTC
CAGCTGCTGCCCGACTACGAGCAGCGCGTCCAGGTGCTCAAGGAGCTTGGCTTCGTCGACGACGCCACGCGGATC
CAGCTCAAGGGCAAGGTGGCCTGCGAGGTGCACTCGGGCGACGAGCTGGTCCTGACGGAACTCATCCTCGACAAC
GTGCTCGCCGACTTCGAGCCGGCCGAGATTGCGGCCCTCCTGTCGTCGTTTGTGTTCCAGGAGAAGACGCTGGTG
GAGCCGACGCTCACGGGGAACCTCTCGCGCGGACGCGACACGATCGTAGCCATCTCGGAAAAGGTCAACGACGTG
CAGACGCGGCTGCAGGTGATCCAGTCGTCGGACGAGTCCAACGACTTCGTGTCGCGGCCGCGGTTCGGACTGATG
GAGGTGGTGTACGAGTGGGCGCGCGGCATGAGCTTCAAGAACATCACGGCGCTGACGGACGTGCTCGAGGGGACC
ATCGTCCGGACCATCACGCGGCTGGACGAGACGTGTCGGGAGGTGAAGAACGCGGCGCGCATCGTGGGCGACCCG
GAGCTGTACCAGAAGATGCAGCAAGCGCAGGAGCTGATCAAGAGGGACATTACCGCGGTCGCGAGCCTGTACATG
TGA
Gene >Hirsu2|2020
ATGGCCGGCATCGACGCCCTCCTGCTCTCTCAGGACCAGGGCGAGGGCGCCGGGCGCCAGTCCCGAGATCTGGAC
GAGGCCAAGCGCCAGCTCGAGGAACGCTTCCTGCTGCCGTCGGCCGCCTTCTCGACCGAATGGCTCAATCGCCTG
CAGCAGCGCTGGGACTTCGAGGCCGACTACCCTTCGCTCTTCAAGATTGCCCCCCCGCAGACTCGCACAGTCACC
CGCTTCCTGCGCCGAGGCCTCGAGGGCAGGGTGACCGGCTACGAGAACGTGACGGTGCCGGTCAGCAGTGCCACG
GCCAAGAACTCGACCAGCCTGCTGCGGAAGCCCGCGAGCCGGGCCGAATTCGTCAGGGGAGCTGCCGGCTTCTTC
CCCTTTGCCCCGGGCGGCCTGGACGGTATCGAGGCGACGGCTGCTCTCGAGGACCAGGTCCATGCCGGCGGGACG
GCCGGCGACGCTGCACCTGGTGCCAACAAGCTCGACAGGGTCATTCAGCTCGGCACCCAAGGAGGCTTGCTCGAG
GTCGCCCCCGGTCTGGAGCGCGGCATCGACTTCAGCAAGCGGAAGTCTCCCGCAGACGACGAGGACGCCAACGTC
ATCGAGCAAGTGCTTCAAGAGGATCCGGAAGACGCAGGCAGCGCAGGAGTGGATGACGGCGGCGTCTCGCCCCGT
GAGCCCGCGCCGGACGCCACCAACGGCGACGAGGACGGCGACGACATCGACGACATCCTGCCAGTCGAGTTCCCT
TCGCTCGAGCCCCATGGCGTCCTTGCTGCGTCCAGTGCTAGGAAGGCTGGCCGCGAGTGGGCGCACATGGTCGAC
ATCAGGCACGGCATGCCCAACTTCCGCGAGCTCGTGCCTGATATGGCTCGCGAGTGGCCCTTCGAGCTCGACACC
TTCCAGAAGGAAGCCGTCTACCATCTGGAGAACGGAGACTCGGTCTTTGTCGCGGCGCACACCTCGGCCGGCAAG
ACTGTCGTAGCCGAATATGCCATCGCGCTGGCGTCCAAGCACATGACCAAGGCCATCTATACGTCCCCGATCAAG
GCCCTCAGCAACCAGAAGTTCCGCGACTTTAGAAACGACTTCAGCGACGTCGGCATCTTAACCGGCGACGTTCAG
ATTAATCCCGAGGCCAGCTGTCTCATTATGACGACGGAGATCCTGCGGAGTATGCTATATAGGGGAGCCGACCTG
ATTCGAGACGTCGAGTTCGTCATCTTCGACGAGGTGCACTACGTCAACGACTTCGAGCGAGGCGTCGTCTGGGAA
GAGGTCATCATCATGCTGCCCGAGCATGTCTCTCTCATCCTCCTCTCGGCCACCGTTCCCAATACGTACGAATTT
GCGTCGTGGGTAGGCCGCACCAAACAGAAGGACATATACGTCATCTCAACGTCCAAGCGGCCCGTCCCTCTGGAG
CACTATCTCTGGGCCGGCAAGAACATCCATCGGATTGTCGATGCTGACAAGAAATTTGTCGATAACGGGTGGAAG
GACGCCCACTCCGCCTCCCAACGCAAAGACAAGCCCAAGGCAGCCGATAACTCCATGGCCGTGCGTGGCGGCAAT
CCTCGTGGCGGCCAGCGCGGCGGCCCTCAGAGGGGCGGCCATCAGCAGCAACGCGGTGGAGGCCGAGGAGCTGGC
GGCGGTCATCAGCGCGGCGGCGGCGCGCAAAGGGGGCGCGGAGGCCCTCCCCGTGCCAGTTACACCCCCGGCCAC
ATGGGTCGGGCTGGGCGCCCCGGGGGCATGTCGTCGGCAGCCCAGGACAAGAACCTCTGGGTCCATCTCGTCCAG
TTCCTCCGCAAGCAGAGCCTGCTGCCGGCATGCATCTTCGTCTTCTCCAAGAAACGGTGCGAAGAGAATGCGGAC
GCGTTGAGCAACCAGGACTTTTGCACAGCAACTGAGAAGAGCCACATCCACATGATCATCGAAAAGTCGGTCGCG
CGGCTGAAGCCCGAGGACAGGGTCTTGCCCCAGATCGTCAGGCTCAGGGAGCTGCTGGGCCGCGGCATCGCCGTT
CATCACGGGGGCCTGCTACCGATCGTGAAGGAACTGGTGGAGATTCTGTTTGCCCAGACGTTGGTCAAAGTTCTC
TTCGCCACAGAGACGTTTGCCATGGGGCTCAACCTGCCGACGCGAACCGTCGTCTTTTCCGGCTACCGCAAGCAT
GACGGGCACTCGTTCCGGAACCTGCTCCCTGGCGAGTACACGCAGATGGCGGGCCGAGCTGGCCGCCGCGGCCTC
GACACCGTCGGCTCCGTCATCATCGTGCCCCCTGGTGGCTCGGATGACGTACCTCCCGTGGCGGAGCTGCGGAAC
ATGATCCTCGGCGAGCCGTCCAAGCTCCGATCGCAGTTCCGCTTGACGTACAACATGATTCTCAACCTGCTACGT
GTCGAGGCGCTCAAGATTGAAGAGATGATCAAGCGCAGCTTCTCCGAACACGCCACCCAGCAGCTGCTCCCCGAG
CACGAAAAGGACGTCAAGCTGGCGCAGGCCGATCTGGCCAAGGTCAAGCGGGAGCCGTGCAAGACGTGCGACACC
GCCATGGACGAGTGCCACCAAGCCGCCCAGGATTACAAGCAACTCACGCTCGAGCTCTACAAGGGGCTGCTCAGA
ATCACCATCGGGCGCAAGATGTTCATGCCTCAGCGGCTCGTCGTCTTCAGCTGGGAAGGCATCCGCACCGTCGGC
CTGCTCGTCTCCGAGGGCATGAGCCCCAGGGGCTCTTTGGACGAGCCCATCTTGCAGGTCTGCGCCGTCAAGCCC
CTCCGCGAGCGGCGCGACGCCTCGGATCAGCTCCCCTTCATTCCCGCGTTCCGCAGGTACCTGCACAAGCTGCCC
CAAGGCAAGCGACGGATGCAGGTGAGGATGCTGCACGTGCCCCTCAGCGACGTCGAGTGCGTCACGCGATGGGTG
GTCAAGGGCACTATTCCCGACATCTTCACGCACGGCCCACCGGGATACCAGGCCATAGACCGAATGCAGGAGGTT
TGCTATGCTTGGGACGACAGGTGGGATGAGGCCGACATGGGCAAGATCAAGAGCCTACAGCTTCAGGAGATTGTG
GAGAAGAGGACGCAGCTCGTCAAGCTGATGTCGCTCTCGCCCGCAGCGCGGTGTCCTTCCTTTTTAAAGCATGTG
AGTGACGTCCGCTTGTTCAGGACGCCCGTCCGCGTGTTGGCAGGATTGGCAGAGTGAGAGGGGGGGGATGCTAAC
GAAAGGGGTGAACCCAGTTTGCCATGTGCCACGACGAATGGCTCATCAAGGAGCATATTTCGCAGCTCAAGCAAT
CTCTCTCGGACCAGAACCTCCAGCTGCTGCCCGACTACGAGCAGCGCGTCCAGGTGCTCAAGGAGCTTGGCTTCG
TCGACGACGCCACGCGGATCCAGCTCAAGGGCAAGGTGGCCTGCGAGGTGCACTCGGGCGACGAGCTGGTCCTGA
CGGAACTCATCCTCGACAACGTGCTCGCCGACTTCGAGCCGGCCGAGATTGCGGCCCTCCTGTCGTCGTTTGTGT
TCCAGGAGAAGACGCTGGTGGAGCCGACGCTCACGGGGAACCTCTCGCGCGGACGCGACACGATCGTAGCCATCT
CGGAAAAGGTCAACGACGTGCAGACGCGGCTGCAGGTGATCCAGTCGTCGGACGAGTCCAACGACTTCGTGTCGC
GGCCGCGGTTCGGACTGATGGAGGTGGTGTACGAGTGGGCGCGCGGCATGAGCTTCAAGAACATCACGGCGCTGA
CGGACGTGCTCGAGGGGACCATCGTCCGGACCATCACGCGGCTGGACGAGACGTGTCGGGAGGTGAAGAACGCGG
CGCGCATCGTGGGCGACCCGGAGCTGTACCAGAAGATGCAGCAAGCGCAGGAGCTGATCAAGAGGGACATTACCG
CGGTCGCGAGCCTGTACATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail