Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2016
Gene name
LocationContig_147:1357..2967
Strand-
Gene length (bp)1610
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 4 23 19
2 44 64 20
3 95 117 22
4 130 152 22
5 178 200 22
6 212 234 22
7 244 266 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2016
MELITSLAIESWILYALGVVVVACRIVSRRIKLGKWRALMIDDYLMVFALINFTGVVVCINEVAKNGSNYMPPEA
AAALTPAGVRMAVYGSIMTFVLEIFTLTATWTVKACLLILYARLTSNTMTRQHTLVKVAAVYCAITYLIVILMFI
FYWCSPTHEYWAVPVKITQCATYYHHMIFATACNISSDLLLLFIPIPIIIKTRLPAKRKAILCLILGLGVFNILA
AILNRYYNFSTPNSYVFLFWYVAEVGVAVMVGNLPLCWPILRLVLGNTEVSKTPSYHGDTISGSNHRKRRLRNPL
ATMGTTVMGTKWDKLEDQEGHAATSDGSQTQQAGSDNGSQIELVLQGHKHNHHHHAAVSANGNEDQENKQPYEVP
TTESVSGGSSGGDKIMVVTTVDVSSESPR*
Coding >Hirsu2|2016
ATGGAGCTCATCACCTCTTTGGCCATCGAGTCGTGGATTCTCTACGCCCTGGGCGTCGTCGTCGTCGCCTGCCGC
ATCGTCTCTCGCCGCATCAAGCTTGGCAAATGGAGAGCTCTCATGATAGACGACTACCTCATGGTTTTCGCCCTG
ATCAACTTTACCGGAGTCGTTGTCTGCATCAATGAAGTCGCCAAGAATGGCAGCAACTACATGCCTCCCGAGGCA
GCCGCCGCCCTCACGCCCGCTGGCGTCCGCATGGCCGTCTACGGCAGCATCATGACGTTTGTCCTCGAGATTTTC
ACTTTGACGGCGACGTGGACGGTCAAGGCCTGCCTCCTGATCCTCTACGCACGCCTGACGAGCAACACTATGACG
AGGCAGCACACATTGGTCAAGGTTGCCGCCGTCTATTGCGCGATAACGTACCTGATCGTCATCTTGATGTTCATC
TTTTATTGGTGCAGCCCTACCCACGAGTACTGGGCCGTGCCGGTGAAAATCACGCAATGCGCCACGTACTATCAC
CACATGATCTTTGCCACGGCATGCAACATCTCCTCCGATCTTCTGCTCCTCTTTATCCCGATCCCGATCATCATC
AAGACCCGCTTGCCGGCCAAAAGGAAAGCTATTCTCTGCTTGATTCTCGGACTCGGCGTTTTCAATATCCTTGCC
GCCATCCTCAACCGATACTACAATTTCAGCACCCCCAACTCGTACGTCTTCTTGTTTTGGTACGTTGCCGAGGTG
GGCGTGGCCGTCATGGTCGGCAACCTTCCACTCTGCTGGCCCATACTGCGGCTGGTGCTGGGAAACACCGAAGTA
TCCAAGACACCGTCGTACCACGGCGACACGATCAGCGGCAGCAACCACCGCAAGAGGCGATTGCGCAACCCGCTG
GCGACGATGGGCACGACGGTCATGGGCACCAAGTGGGATAAGCTGGAAGACCAAGAGGGCCACGCCGCGACGAGC
GACGGGTCGCAGACGCAGCAAGCCGGATCGGACAACGGGAGCCAGATCGAGCTAGTGCTGCAGGGACACAAACAC
AACCACCACCACCACGCGGCCGTGAGCGCCAACGGAAACGAGGACCAAGAAAACAAGCAGCCGTACGAGGTCCCG
ACGACGGAGTCGGTGAGCGGCGGCAGCAGCGGCGGCGACAAGATCATGGTCGTGACGACGGTCGACGTTTCGTCG
GAGTCGCCACGGTGA
Transcript >Hirsu2|2016
ATGGAGCTCATCACCTCTTTGGCCATCGAGTCGTGGATTCTCTACGCCCTGGGCGTCGTCGTCGTCGCCTGCCGC
ATCGTCTCTCGCCGCATCAAGCTTGGCAAATGGAGAGCTCTCATGATAGACGACTACCTCATGGTTTTCGCCCTG
ATCAACTTTACCGGAGTCGTTGTCTGCATCAATGAAGTCGCCAAGAATGGCAGCAACTACATGCCTCCCGAGGCA
GCCGCCGCCCTCACGCCCGCTGGCGTCCGCATGGCCGTCTACGGCAGCATCATGACGTTTGTCCTCGAGATTTTC
ACTTTGACGGCGACGTGGACGGTCAAGGCCTGCCTCCTGATCCTCTACGCACGCCTGACGAGCAACACTATGACG
AGGCAGCACACATTGGTCAAGGTTGCCGCCGTCTATTGCGCGATAACGTACCTGATCGTCATCTTGATGTTCATC
TTTTATTGGTGCAGCCCTACCCACGAGTACTGGGCCGTGCCGGTGAAAATCACGCAATGCGCCACGTACTATCAC
CACATGATCTTTGCCACGGCATGCAACATCTCCTCCGATCTTCTGCTCCTCTTTATCCCGATCCCGATCATCATC
AAGACCCGCTTGCCGGCCAAAAGGAAAGCTATTCTCTGCTTGATTCTCGGACTCGGCGTTTTCAATATCCTTGCC
GCCATCCTCAACCGATACTACAATTTCAGCACCCCCAACTCGTACGTCTTCTTGTTTTGGTACGTTGCCGAGGTG
GGCGTGGCCGTCATGGTCGGCAACCTTCCACTCTGCTGGCCCATACTGCGGCTGGTGCTGGGAAACACCGAAGTA
TCCAAGACACCGTCGTACCACGGCGACACGATCAGCGGCAGCAACCACCGCAAGAGGCGATTGCGCAACCCGCTG
GCGACGATGGGCACGACGGTCATGGGCACCAAGTGGGATAAGCTGGAAGACCAAGAGGGCCACGCCGCGACGAGC
GACGGGTCGCAGACGCAGCAAGCCGGATCGGACAACGGGAGCCAGATCGAGCTAGTGCTGCAGGGACACAAACAC
AACCACCACCACCACGCGGCCGTGAGCGCCAACGGAAACGAGGACCAAGAAAACAAGCAGCCGTACGAGGTCCCG
ACGACGGAGTCGGTGAGCGGCGGCAGCAGCGGCGGCGACAAGATCATGGTCGTGACGACGGTCGACGTTTCGTCG
GAGTCGCCACGGTGA
Gene >Hirsu2|2016
ATGGAGCTCATCACCTCTTTGGCCATCGAGTCGTGGATTCTCTACGCCCTGGGCGTCGTCGTCGTCGCCTGCCGC
ATCGTCTCTCGCCGCATCAAGCTTGGCAAATGGAGAGCTCTCATGATAGACGACTACCTCATGGTTTTCGCCCTG
GTACGTCTGCGCCTGGCCATCCACCTCCTGCTGCCTCTTTTGCGCCATGTCGTCGCACTCTCGCCCACCTCCTGC
CCGCAGCCTCCAGTCAGTTAGGCCGGCTTCCTGACGCGGCCCAGATCAACTTTACCGGAGTCGTTGTCTGCATCA
ATGAAGTCGCCAAGAATGGCAGCAACTACATGCCTCCCGAGGCAGCCGCCGCCCTCACGCCCGCTGGCGTCCGCA
TGGCCGTCTACGGCAGCATCATGACGTTTGTCCTCGAGATTTTCACTTTGACGGCGACGTGGACGGTCAAGGCCT
GCCTCCTGATCCTCTACGCACGCCTGACGTGCGTTACCCCCCCTCCCCCACGCCCCCCCAATTCGAGTCGAAACT
CGTCCCCTTCTTCGGCCCTGTCCGCTGACGGCGACTGGCCTGGTCCTTGCAGGAGCAACACTATGACGAGGCAGC
ACACATTGGTCAAGGTTGCCGCCGTCTATTGCGCGATAACGTACCTGATCGTCATCTTGATGTTCATCTTTTATT
GGTGCAGCCCTACCCACGAGTACTGGGCCGTGCCGGTGAAAATCAGTACGGCGACCCGAACGAGACAGACACACG
GCTCGGAGAGTCGGCTAACGAAAGCGCAGCGCAATGCGCCACGTACTATCACCACATGATCTTTGCCACGGCATG
CAACATCTCCTCCGATCTTCTGCTCCTCTTTATCCCGATCCCGATCATCATCAAGACCCGCTTGCCGGCCAAAAG
GTGGGGACATCAGACGACGGGTCGGAGGCGATTGGCTGACGGATGGGACAGGAAAGCTATTCTCTGCTTGATTCT
CGGACTCGGCGTTTTCAATGTAAGGGCGGGCCCGTCCCGAACTGCCCGCGGAAGTCAGGCCTGCTCACCCGTCTC
CGCCTCTGCAGATCCTTGCCGCCATCCTCAACCGATACTACAATTTCAGCACCCCCAACTCGTACGTCTTCTTGT
TTTGGTACGTTGCCGAGGTGGGCGTGGCCGTCATGGTCGGCAACCTTCCACTCTGCTGGCCCATACTGCGGCTGG
TGCTGGGAAACACCGAAGTATCCAAGACACCGTCGTACCACGGCGACACGATCAGCGGCAGCAACCACCGCAAGA
GGCGATTGCGCAACCCGCTGGCGACGATGGGCACGACGGTCATGGGCACCAAGTGGGATAAGCTGGAAGACCAAG
AGGGCCACGCCGCGACGAGCGACGGGTCGCAGACGCAGCAAGCCGGATCGGACAACGGGAGCCAGATCGAGCTAG
TGCTGCAGGGACACAAACACAACCACCACCACCACGCGGCCGTGAGCGCCAACGGAAACGAGGACCAAGAAAACA
AGCAGCCGTACGAGGTCCCGACGACGGAGTCGGTGAGCGGCGGCAGCAGCGGCGGCGACAAGATCATGGTCGTGA
CGACGGTCGACGTTTCGTCGGAGTCGCCACGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail