© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|2006 |
| Gene name | |
| Location | Contig_1465:2..1830 |
| Strand | - |
| Gene length (bp) | 1828 |
| Transcript length (bp) | 1785 |
| Coding sequence length (bp) | 1785 |
| Protein length (aa) | 595 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00122 | E1-E2_ATPase | E1-E2 ATPase | 3.2E-47 | 383 | 580 |
| PF00403 | HMA | Heavy-metal-associated domain | 5.6E-13 | 42 | 102 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8CN02|COPA_STAES | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 | 42 | 588 | 9.0E-72 |
| sp|Q5HL56|COPA_STAEQ | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 | 42 | 588 | 9.0E-72 |
| sp|Q9XT50|ATP7B_SHEEP | Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 | 40 | 588 | 2.0E-70 |
| sp|Q64535|ATP7B_RAT | Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 | 31 | 588 | 2.0E-70 |
| sp|Q4L970|COPA_STAHJ | Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 | 40 | 588 | 4.0E-69 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8CN02|COPA_STAES | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 | 42 | 588 | 9.0E-72 |
| sp|Q5HL56|COPA_STAEQ | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 | 42 | 588 | 9.0E-72 |
| sp|Q9XT50|ATP7B_SHEEP | Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 | 40 | 588 | 2.0E-70 |
| sp|Q64535|ATP7B_RAT | Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 | 31 | 588 | 2.0E-70 |
| sp|Q4L970|COPA_STAHJ | Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 | 40 | 588 | 4.0E-69 |
| sp|Q9SH30|HMA5_ARATH | Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 | 37 | 588 | 3.0E-68 |
| sp|Q64446|ATP7B_MOUSE | Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 | 40 | 588 | 4.0E-68 |
| sp|P35670|ATP7B_HUMAN | Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 | 40 | 588 | 8.0E-68 |
| sp|Q6GDP1|COPA_STAAR | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 | 40 | 588 | 3.0E-65 |
| sp|A8Z3F8|COPA_STAAT | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 | 40 | 588 | 8.0E-65 |
| sp|Q2FDV0|COPA_STAA3 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 | 40 | 588 | 8.0E-65 |
| sp|A6QK47|COPA_STAAE | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 | 40 | 588 | 8.0E-65 |
| sp|Q5HCZ3|COPA_STAAC | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 | 40 | 588 | 8.0E-65 |
| sp|Q2FV64|COPA_STAA8 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 | 40 | 588 | 8.0E-65 |
| sp|Q8NUQ9|COPA_STAAW | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 | 40 | 588 | 8.0E-65 |
| sp|Q6G6B7|COPA_STAAS | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 | 40 | 588 | 8.0E-65 |
| sp|Q2YWA3|COPA_STAAB | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 | 40 | 588 | 9.0E-65 |
| sp|Q7A3E6|COPA_STAAN | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 | 40 | 588 | 1.0E-63 |
| sp|Q99R80|COPA_STAAM | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 | 40 | 588 | 1.0E-63 |
| sp|A5IVY3|COPA_STAA9 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 | 40 | 588 | 1.0E-63 |
| sp|A6U4T8|COPA_STAA2 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 | 40 | 588 | 1.0E-63 |
| sp|A7X6S1|COPA_STAA1 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 | 40 | 588 | 1.0E-63 |
| sp|P70705|ATP7A_RAT | Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 | 8 | 588 | 9.0E-63 |
| sp|Q4A0G1|COPA_STAS1 | Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 | 40 | 588 | 2.0E-62 |
| sp|Q9S7J8|HMA7_ARATH | Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 | 19 | 588 | 2.0E-62 |
| sp|Q04656|ATP7A_HUMAN | Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 | 40 | 588 | 3.0E-62 |
| sp|Q64430|ATP7A_MOUSE | Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 | 40 | 588 | 4.0E-60 |
| sp|P49015|ATP7A_CRIGR | Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 | 40 | 588 | 5.0E-56 |
| sp|P58341|ATCU1_RHIME | Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 | 28 | 588 | 6.0E-55 |
| sp|O59666|ATU2_SCHPO | Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 | 38 | 588 | 3.0E-53 |
| sp|O32220|COPA_BACSU | Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 | 43 | 588 | 2.0E-50 |
| sp|Q9X5X3|ATCU_SINMW | Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 | 47 | 588 | 3.0E-49 |
| sp|P38995|ATU2_YEAST | Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 | 43 | 588 | 1.0E-46 |
| sp|P58342|ATCU2_RHIME | Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 | 33 | 588 | 2.0E-46 |
| sp|P73241|ATCS_SYNY3 | Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 | 121 | 586 | 3.0E-45 |
| sp|P32113|COPA_ENTHA | Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 | 118 | 588 | 6.0E-45 |
| sp|O08462|COPA3_HELPX | Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 | 210 | 586 | 8.0E-44 |
| sp|P37279|ATCS_SYNE7 | Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 | 142 | 586 | 2.0E-43 |
| sp|Q9ZM69|COPA_HELPJ | Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 | 210 | 586 | 3.0E-43 |
| sp|Q59467|COPA2_HELPX | Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 | 210 | 586 | 4.0E-43 |
| sp|P55989|COPA_HELPY | Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 | 286 | 586 | 7.0E-43 |
| sp|O29777|COPA_ARCFU | Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 | 263 | 587 | 7.0E-43 |
| sp|P77871|COPA1_HELPX | Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 | 210 | 586 | 4.0E-42 |
| sp|Q9ZHC7|SILP_SALTM | Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 | 214 | 587 | 5.0E-42 |
| sp|Q8ZR95|COPA_SALTY | Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 | 43 | 586 | 4.0E-41 |
| sp|Q8Z8S4|COPA_SALTI | Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 | 43 | 586 | 4.0E-40 |
| sp|P9WPS3|CTPV_MYCTU | Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 | 310 | 588 | 6.0E-40 |
| sp|P9WPS2|CTPV_MYCTO | Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 | 310 | 588 | 6.0E-40 |
| sp|O32619|COPA_HELFC | Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 | 246 | 586 | 3.0E-39 |
| sp|Q9SZC9|HMA6_ARATH | Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 | 310 | 588 | 4.0E-38 |
| sp|Q59385|COPA_ECOLI | Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 | 43 | 586 | 9.0E-38 |
| sp|Q8XD24|COPA_ECO57 | Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 | 43 | 586 | 1.0E-37 |
| sp|P37385|ATSY_SYNE7 | Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 | 310 | 588 | 6.0E-37 |
| sp|P07893|ATSY_SYNP6 | Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 | 310 | 588 | 2.0E-36 |
| sp|Q69HU0|COPB_STAAU | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 | 254 | 587 | 4.0E-34 |
| sp|Q6GIX4|COPB_STAAR | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 | 254 | 587 | 7.0E-34 |
| sp|O30085|COPB_ARCFU | Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 | 265 | 586 | 1.0E-33 |
| sp|P9WPT9|CTPB_MYCTU | Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 | 265 | 587 | 3.0E-33 |
| sp|P9WPT8|CTPB_MYCTO | Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 | 265 | 587 | 3.0E-33 |
| sp|P59947|CTPB_MYCBO | Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 | 265 | 587 | 3.0E-33 |
| sp|Q8ZCA7|COPA_YERPE | Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 | 114 | 586 | 4.0E-33 |
| sp|P38360|ATU1_YEAST | P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 | 268 | 586 | 8.0E-33 |
| sp|P77868|Y290_HAEIN | Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 | 121 | 586 | 4.0E-32 |
| sp|O33533|FIXI_RHILV | Nitrogen fixation protein FixI OS=Rhizobium leguminosarum bv. viciae GN=fixI PE=3 SV=1 | 121 | 588 | 1.0E-31 |
| sp|P46840|CTPB_MYCLE | Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 | 108 | 587 | 3.0E-31 |
| sp|Q8CQF7|COPB_STAES | Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 | 265 | 587 | 2.0E-30 |
| sp|Q9KPZ7|COPA_VIBCH | Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 | 310 | 586 | 2.0E-30 |
| sp|Q4LAB1|COPB_STAHJ | Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 | 265 | 587 | 5.0E-30 |
| sp|A8YZ02|COPB_STAAT | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 | 265 | 587 | 8.0E-30 |
| sp|Q2FKI2|COPB_STAA3 | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 | 265 | 587 | 8.0E-30 |
| sp|Q5HKB0|COPB_STAEQ | Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 | 265 | 587 | 9.0E-30 |
| sp|B9DFX7|HMA8_ARATH | Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 | 295 | 588 | 1.0E-29 |
| sp|P05425|COPB_ENTHA | Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 | 265 | 587 | 2.0E-29 |
| sp|Q9X5V3|ATCU_RHILV | Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 | 246 | 586 | 4.0E-28 |
| sp|P9WPU1|CTPA_MYCTU | Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 | 116 | 587 | 4.0E-28 |
| sp|P9WPU0|CTPA_MYCTO | Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 | 116 | 587 | 4.0E-28 |
| sp|P18398|FIXI_RHIME | Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 | 265 | 588 | 7.0E-28 |
| sp|Q59998|ATZN_SYNY3 | Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 | 116 | 587 | 2.0E-25 |
| sp|P46839|CTPA_MYCLE | Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 | 206 | 587 | 2.0E-25 |
| sp|P58414|CADA_LISMO | Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 | 353 | 588 | 5.0E-25 |
| sp|Q59207|FIXI_BRADU | Nitrogen fixation protein FixI OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixI PE=3 SV=1 | 267 | 588 | 1.0E-24 |
| sp|P20021|CADA1_STAAU | Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 | 350 | 588 | 3.0E-24 |
| sp|Q6GIX1|CADA_STAAR | Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 | 348 | 588 | 4.0E-24 |
| sp|O31688|ZOSA_BACSU | Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 | 347 | 587 | 9.0E-24 |
| sp|P30336|CADA_BACPE | Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 | 346 | 588 | 1.0E-23 |
| sp|P37386|CADA2_STAAU | Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 | 305 | 588 | 3.0E-23 |
| sp|Q60048|CADA_LISMN | Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 | 365 | 588 | 3.0E-22 |
| sp|P37617|ATZN_ECOLI | Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 | 350 | 571 | 4.0E-22 |
| sp|O32219|CADA_BACSU | Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 | 343 | 587 | 6.0E-22 |
| sp|Q9SZW4|HMA2_ARATH | Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 | 348 | 587 | 8.0E-22 |
| sp|Q59465|HMCT_HELPY | Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 | 349 | 587 | 2.0E-20 |
| sp|Q9CCL1|CTPC_MYCLE | Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 | 350 | 590 | 2.0E-19 |
| sp|Q9ZL53|HMCT_HELPJ | Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 | 349 | 587 | 1.0E-18 |
| sp|P9WPT5|CTPC_MYCTU | Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 | 350 | 590 | 9.0E-18 |
| sp|P9WPT4|CTPC_MYCTO | Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 | 350 | 590 | 9.0E-18 |
| sp|P0A503|CTPC_MYCBO | Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 | 350 | 590 | 9.0E-18 |
| sp|O64474|HMA4_ARATH | Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 | 348 | 586 | 1.0E-17 |
| sp|P9WPS7|CTPG_MYCTU | Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 | 365 | 588 | 1.0E-17 |
| sp|P9WPS6|CTPG_MYCTO | Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 | 365 | 588 | 1.0E-17 |
| sp|P63690|CTPG_MYCBO | Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 | 365 | 588 | 1.0E-17 |
| sp|P0CW77|HMA3A_ARATH | Putative inactive cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=5 SV=1 | 351 | 588 | 3.0E-16 |
| sp|P0CW78|HMA3B_ARATH | Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 | 351 | 588 | 5.0E-16 |
| sp|Q9RQB4|HMCT_HELFE | Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 | 350 | 586 | 7.0E-16 |
| sp|A0R3A7|CTPD_MYCS2 | Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 | 349 | 586 | 2.0E-15 |
| sp|P9WPT3|CTPD_MYCTU | Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 | 349 | 586 | 5.0E-15 |
| sp|P9WPT2|CTPD_MYCTO | Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 | 349 | 586 | 5.0E-15 |
| sp|P63686|CTPD_MYCBO | Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 | 349 | 586 | 5.0E-15 |
| sp|P9WPT7|CTPJ_MYCTU | Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 | 350 | 586 | 8.0E-13 |
| sp|P9WPT6|CTPJ_MYCTO | Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 | 350 | 586 | 8.0E-13 |
| sp|O32328|KDPB_CLOAB | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 | 349 | 528 | 2.0E-11 |
| sp|P9WPU3|KDPB_MYCTU | Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 | 349 | 519 | 2.0E-11 |
| sp|P9WPU2|KDPB_MYCTO | Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 | 349 | 519 | 2.0E-11 |
| sp|P63682|KDPB_MYCBO | Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 | 349 | 519 | 2.0E-11 |
| sp|Q8XU11|KDPB_RALSO | Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 | 321 | 564 | 3.0E-11 |
| sp|Q4LAI2|KDPB_STAHJ | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 | 375 | 588 | 4.0E-11 |
| sp|A7GLG4|KDPB_BACCN | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 | 408 | 523 | 2.0E-10 |
| sp|Q7N6W6|KDPB_PHOLL | Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 | 354 | 564 | 3.0E-10 |
| sp|Q8KU73|KDPB_ENTFA | Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 | 347 | 564 | 3.0E-10 |
| sp|Q5HK64|KDPB_STAEQ | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 | 375 | 588 | 3.0E-10 |
| sp|Q6GKN3|KDPB1_STAAR | Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 | 375 | 588 | 3.0E-10 |
| sp|P0A008|KDPB1_STAAN | Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 | 375 | 588 | 3.0E-10 |
| sp|P0A007|KDPB1_STAAM | Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 | 375 | 588 | 3.0E-10 |
| sp|A4W860|KDPB_ENT38 | Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 | 354 | 523 | 5.0E-10 |
| sp|Q47H39|KDPB_DECAR | Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 | 321 | 519 | 6.0E-10 |
| sp|Q2YUH7|KDPB_STAAB | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|P63684|KDPB2_STAAN | Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|P63683|KDPB2_STAAM | Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|Q8NVI2|KDPB_STAAW | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|Q6G7N3|KDPB_STAAS | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|A8Z4X9|KDPB_STAAT | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|A6QIS1|KDPB_STAAE | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|Q5HEC4|KDPB_STAAC | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|Q6GEZ7|KDPB2_STAAR | Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 | 366 | 498 | 6.0E-10 |
| sp|P57700|KDPB_THEAC | Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 | 346 | 588 | 7.0E-10 |
| sp|B8DAW1|KDPB_LISMH | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 | 407 | 588 | 9.0E-10 |
| sp|Q8Y3Z7|KDPB_LISMO | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 | 407 | 588 | 1.0E-09 |
| sp|Q71W90|KDPB_LISMF | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 | 407 | 588 | 1.0E-09 |
| sp|C1KZN5|KDPB_LISMC | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 | 407 | 588 | 1.0E-09 |
| sp|Q927G0|KDPB1_LISIN | Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 | 407 | 588 | 1.0E-09 |
| sp|Q0TRT3|KDPB_CLOP1 | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 | 398 | 523 | 1.0E-09 |
| sp|Q97BF6|KDPB_THEVO | Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 | 347 | 588 | 2.0E-09 |
| sp|Q9RZP0|KDPB_DEIRA | Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 | 409 | 588 | 3.0E-09 |
| sp|Q8R8I6|KDPB_CALS4 | Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 | 352 | 520 | 3.0E-09 |
| sp|Q98GX6|KDPB_RHILO | Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 | 346 | 575 | 4.0E-09 |
| sp|B7N9U0|KDPB_ECOLU | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 6.0E-09 |
| sp|B5YQN9|KDPB_ECO5E | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 | 360 | 529 | 6.0E-09 |
| sp|Q8X9F9|KDPB_ECO57 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 | 360 | 529 | 6.0E-09 |
| sp|B1LLE1|KDPB_ECOSM | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 6.0E-09 |
| sp|B2TMJ2|KDPB_CLOBB | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 | 390 | 523 | 6.0E-09 |
| sp|B6HYQ5|KDPB_ECOSE | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 | 364 | 529 | 6.0E-09 |
| sp|A7ZJ80|KDPB_ECO24 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 6.0E-09 |
| sp|B7LKR7|KDPB_ESCF3 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 | 364 | 529 | 6.0E-09 |
| sp|B7NMQ0|KDPB_ECO7I | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 6.0E-09 |
| sp|B2TTJ7|KDPB_SHIB3 | Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 | 360 | 529 | 6.0E-09 |
| sp|Q3Z4A6|KDPB_SHISS | Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 | 364 | 529 | 6.0E-09 |
| sp|Q324L0|KDPB_SHIBS | Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|P03960|KDPB_ECOLI | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 | 364 | 529 | 7.0E-09 |
| sp|B1X6M8|KDPB_ECODH | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|C4ZWH3|KDPB_ECOBW | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|B7M5L3|KDPB_ECO8A | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|B7LAA4|KDPB_ECO55 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|Q8FJV4|KDPB_ECOL6 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|Q0TJY9|KDPB_ECOL5 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|B7UKX6|KDPB_ECO27 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|B7MPK0|KDPB_ECO81 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 | 364 | 529 | 7.0E-09 |
| sp|Q93MV5|KDPB_MYXXA | Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 | 270 | 530 | 8.0E-09 |
| sp|B2V2P3|KDPB_CLOBA | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 | 321 | 523 | 8.0E-09 |
| sp|B1IY32|KDPB_ECOLC | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 | 405 | 529 | 8.0E-09 |
| sp|A7ZXV8|KDPB_ECOHS | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 | 405 | 529 | 8.0E-09 |
| sp|A0AM16|KDPB_LISW6 | Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 | 407 | 588 | 9.0E-09 |
| sp|A4SZG8|KDPB_POLSQ | Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 | 408 | 519 | 1.0E-08 |
| sp|Q926K7|KDPB2_LISIN | Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 | 397 | 528 | 1.0E-08 |
| sp|Q8YPE9|KDPB1_NOSS1 | Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 | 402 | 527 | 1.0E-08 |
| sp|Q8U9D9|KDPB_AGRFC | Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 | 347 | 514 | 1.0E-08 |
| sp|Q8YSD5|KDPB2_NOSS1 | Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 | 408 | 588 | 1.0E-08 |
| sp|C4LDL7|KDPB_TOLAT | Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 | 344 | 519 | 2.0E-08 |
| sp|P57699|KDPB_HALSA | Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 | 408 | 588 | 2.0E-08 |
| sp|B0R9M0|KDPB_HALS3 | Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 | 408 | 588 | 2.0E-08 |
| sp|C1EYK0|KDPB_BACC3 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 | 286 | 523 | 2.0E-08 |
| sp|Q9M3H5|HMA1_ARATH | Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic OS=Arabidopsis thaliana GN=HMA1 PE=2 SV=2 | 353 | 587 | 2.0E-08 |
| sp|B5XZE9|KDPB_KLEP3 | Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 | 354 | 529 | 2.0E-08 |
| sp|Q1REM0|KDPB_ECOUT | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 | 321 | 529 | 2.0E-08 |
| sp|A1A8W1|KDPB_ECOK1 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 | 321 | 529 | 2.0E-08 |
| sp|B7MFW2|KDPB_ECO45 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 | 321 | 529 | 2.0E-08 |
| sp|A6T6D8|KDPB_KLEP7 | Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-08 |
| sp|Q9A7X7|KDPB_CAUCR | Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 | 343 | 519 | 3.0E-08 |
| sp|Q63FR0|KDPB_BACCZ | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 | 409 | 523 | 3.0E-08 |
| sp|Q81HQ0|KDPB_BACCR | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 | 409 | 523 | 3.0E-08 |
| sp|B7HDF9|KDPB_BACC4 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 | 409 | 523 | 3.0E-08 |
| sp|B7HWG1|KDPB_BACC7 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 | 286 | 523 | 3.0E-08 |
| sp|B7II09|KDPB_BACC2 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 | 409 | 523 | 5.0E-08 |
| sp|C3LF99|KDPB_BACAC | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 | 409 | 523 | 5.0E-08 |
| sp|Q9R6X1|KDPB_ANASL | Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 | 405 | 523 | 5.0E-08 |
| sp|Q58623|Y1226_METJA | Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 | 346 | 518 | 6.0E-08 |
| sp|A9VFM1|KDPB_BACWK | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 | 409 | 523 | 6.0E-08 |
| sp|Q92XJ0|KDPB_RHIME | Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 | 399 | 522 | 1.0E-07 |
| sp|A1JQS2|KDPB_YERE8 | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 | 407 | 567 | 1.0E-07 |
| sp|P54679|PMA1_DICDI | Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 | 189 | 491 | 1.0E-07 |
| sp|Q72TM6|KDPB_LEPIC | Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 | 354 | 523 | 1.0E-07 |
| sp|B7JRB8|KDPB_BACC0 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 | 409 | 523 | 2.0E-07 |
| sp|Q6HN78|KDPB_BACHK | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 | 409 | 523 | 2.0E-07 |
| sp|A0RA13|KDPB_BACAH | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 | 409 | 523 | 2.0E-07 |
| sp|B2VJK3|KDPB_ERWT9 | Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 | 325 | 494 | 2.0E-07 |
| sp|A8GB61|KDPB_SERP5 | Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 | 354 | 564 | 3.0E-07 |
| sp|B5BCA4|KDPB_SALPK | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|Q5PCJ7|KDPB_SALPA | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|B5FNE0|KDPB_SALDC | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|B5R670|KDPB_SALG2 | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|Q8ZQW2|KDPB_SALTY | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|Q57RN0|KDPB_SALCH | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|A9MUE0|KDPB_SALPB | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|B4TBA6|KDPB_SALHS | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|B5QWE9|KDPB_SALEP | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|B4TQ22|KDPB_SALSV | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|B4SZB1|KDPB_SALNS | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|B5EZE3|KDPB_SALA4 | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 | 405 | 529 | 3.0E-07 |
| sp|P59219|KDPB_LEPIN | Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 | 354 | 523 | 3.0E-07 |
| sp|P73867|KDPB_SYNY3 | Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 | 408 | 498 | 3.0E-07 |
| sp|P57698|KDPB_PSEAE | Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 | 284 | 515 | 6.0E-07 |
| sp|Q667S4|KDPB_YERPS | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|A4TL06|KDPB_YERPP | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|Q1CKH2|KDPB_YERPN | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|A9R3X3|KDPB_YERPG | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|Q8ZD97|KDPB_YERPE | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|B2KA78|KDPB_YERPB | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|Q1C586|KDPB_YERPA | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|B1JR96|KDPB_YERPY | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|A7FFQ9|KDPB_YERP3 | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 | 407 | 567 | 7.0E-07 |
| sp|Q9Z1W8|AT12A_MOUSE | Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 | 298 | 447 | 3.0E-06 |
| sp|Q64430|ATP7A_MOUSE | Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 | 40 | 144 | 4.0E-06 |
| sp|Q9X8Z9|KDPB_STRCO | Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 | 375 | 519 | 7.0E-06 |
| sp|Q8PCM1|KDPB_XANCP | Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 | 351 | 498 | 9.0E-06 |
| sp|Q7M290|PMA_AVESA | Plasma membrane ATPase (Fragments) OS=Avena sativa PE=1 SV=2 | 410 | 481 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0046872 | metal ion binding | Yes |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 216 | 238 | 22 |
| 2 | 258 | 277 | 19 |
| 3 | 313 | 335 | 22 |
| 4 | 345 | 367 | 22 |
| 5 | 503 | 525 | 22 |
| 6 | 545 | 567 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|2006 LGAGLVAALDDGGEDGAGDAGAAQGVVVEAADAAPAPLLRATVSVGGMTCAVCVNTITDEVQKRPWVSRIVVNLV SNSATVDFTDPDRAADIVEAIEDLGYDAVLDSVVDLRRQRQSADEREMEIHVDGIFCPRCPDRICQTLRNLDASR IDILQEPTPQLPRLRIRYRPELPRLTIRHILGAIEATDPSLRASIYHPPTLEERSRTIRAKHQRELLYRELLTGL IAIPTFVLGIVYMSLVDKDDPTRKHLMQPWRSGLSRLDVILCLLSTPVYFFAADVFHVRAVKELRSLWRGGSRTP LLQRFYKFGSMNMLISLGTSIAYISSVAEMIAVAVRGDDAPVPEGRFYFDSVVFLTLFLLAGRLIEGYSKSKTGN AVEALAKLRPSTALLVEQDKMGKQRTAATPIDQLEQGDVIRVPGGASPAADGIVVAGETNFDESSLTGESRPIRK GPGDEVYAGTINKADAVTVRVTGTCGKSMLDQIVEVVREGQTRRAPVEQIADTLTAYFVPVMTLVAMVTWAVWMA LALSGRVDEAEVRRSGGPAAFAFQFAIAVFVVACPCGLGLAAPTAIFVGGGIAAQHGILAKGGGEARAR* |
| Coding | >Hirsu2|2006 CTGGGCGCCGGCCTCGTCGCCGCGCTTGACGATGGCGGGGAAGACGGCGCAGGCGACGCGGGCGCCGCGCAGGGA GTCGTCGTCGAGGCCGCCGACGCCGCGCCCGCGCCGCTGCTGCGCGCCACCGTGTCCGTCGGCGGCATGACGTGC GCCGTCTGCGTCAACACCATCACCGACGAGGTCCAGAAGCGGCCGTGGGTCTCGCGCATCGTCGTCAACCTCGTC TCCAACAGCGCGACTGTCGACTTCACCGACCCGGACCGCGCCGCCGACATCGTCGAGGCCATCGAGGACCTCGGC TACGACGCCGTCCTCGACTCCGTCGTCGACCTCCGCCGCCAGCGCCAGTCGGCCGACGAGCGCGAGATGGAGATC CACGTCGACGGCATCTTCTGCCCGCGCTGCCCCGACCGCATCTGCCAGACGCTGCGCAACCTGGACGCGTCCCGC ATCGACATCCTCCAGGAGCCCACCCCGCAGCTGCCCCGGCTCCGGATCCGCTACCGGCCCGAGCTCCCCCGGCTG ACCATCCGCCACATCCTCGGCGCCATCGAGGCCACGGACCCGTCCCTGCGCGCCTCCATCTACCACCCCCCCACG CTCGAGGAGCGGTCCAGGACGATCCGGGCCAAGCACCAGCGCGAGCTCCTGTACCGCGAGCTCCTGACCGGCCTC ATCGCCATCCCGACCTTCGTCCTCGGCATCGTCTACATGAGCCTGGTCGACAAGGACGACCCGACGCGCAAGCAC CTCATGCAGCCCTGGAGGTCGGGCCTGAGCCGGCTCGACGTCATCCTCTGCCTCCTCTCCACGCCCGTCTACTTC TTCGCCGCCGACGTCTTCCACGTGCGCGCCGTCAAGGAGCTGCGGTCGCTGTGGCGCGGCGGCAGCCGCACGCCG CTGCTGCAGAGGTTCTACAAGTTCGGCAGCATGAACATGCTCATCTCGCTGGGGACGAGCATCGCCTACATCTCG TCGGTGGCCGAGATGATCGCGGTGGCCGTCCGGGGCGACGACGCCCCCGTGCCCGAGGGCCGCTTCTACTTCGAC TCGGTCGTCTTCCTCACCCTCTTCCTGCTCGCCGGCCGGCTGATCGAGGGCTACAGCAAGTCCAAGACGGGCAAC GCCGTCGAGGCGCTGGCCAAGCTGCGGCCGAGCACGGCCCTGCTCGTCGAGCAGGACAAGATGGGCAAGCAGCGG ACGGCGGCGACGCCCATCGACCAGCTGGAGCAGGGCGACGTGATCCGCGTGCCGGGCGGCGCGTCGCCGGCGGCG GACGGCATCGTCGTCGCCGGCGAGACCAACTTTGACGAGTCGAGCCTGACGGGCGAGTCGCGGCCGATCCGCAAG GGGCCCGGGGACGAAGTCTACGCCGGCACCATCAACAAGGCCGACGCGGTGACGGTGCGCGTGACGGGCACGTGC GGCAAGTCGATGCTGGACCAGATCGTCGAGGTGGTGCGCGAGGGCCAGACGAGGCGGGCGCCGGTGGAGCAGATC GCCGACACGCTGACGGCCTACTTCGTGCCCGTCATGACGCTCGTGGCCATGGTGACGTGGGCGGTGTGGATGGCG CTCGCGCTGAGCGGGCGGGTGGACGAGGCGGAGGTGCGGCGGTCGGGCGGGCCGGCGGCGTTCGCCTTCCAGTTC GCCATCGCCGTCTTCGTCGTGGCGTGCCCGTGCGGGCTGGGCCTGGCGGCGCCGACGGCCATCTTCGTCGGGGGC GGGATCGCGGCCCAGCACGGGATCCTGGCCAAGGGCGGGGGCGAGGCACGGGCACGCTGA |
| Transcript | >Hirsu2|2006 CTGGGCGCCGGCCTCGTCGCCGCGCTTGACGATGGCGGGGAAGACGGCGCAGGCGACGCGGGCGCCGCGCAGGGA GTCGTCGTCGAGGCCGCCGACGCCGCGCCCGCGCCGCTGCTGCGCGCCACCGTGTCCGTCGGCGGCATGACGTGC GCCGTCTGCGTCAACACCATCACCGACGAGGTCCAGAAGCGGCCGTGGGTCTCGCGCATCGTCGTCAACCTCGTC TCCAACAGCGCGACTGTCGACTTCACCGACCCGGACCGCGCCGCCGACATCGTCGAGGCCATCGAGGACCTCGGC TACGACGCCGTCCTCGACTCCGTCGTCGACCTCCGCCGCCAGCGCCAGTCGGCCGACGAGCGCGAGATGGAGATC CACGTCGACGGCATCTTCTGCCCGCGCTGCCCCGACCGCATCTGCCAGACGCTGCGCAACCTGGACGCGTCCCGC ATCGACATCCTCCAGGAGCCCACCCCGCAGCTGCCCCGGCTCCGGATCCGCTACCGGCCCGAGCTCCCCCGGCTG ACCATCCGCCACATCCTCGGCGCCATCGAGGCCACGGACCCGTCCCTGCGCGCCTCCATCTACCACCCCCCCACG CTCGAGGAGCGGTCCAGGACGATCCGGGCCAAGCACCAGCGCGAGCTCCTGTACCGCGAGCTCCTGACCGGCCTC ATCGCCATCCCGACCTTCGTCCTCGGCATCGTCTACATGAGCCTGGTCGACAAGGACGACCCGACGCGCAAGCAC CTCATGCAGCCCTGGAGGTCGGGCCTGAGCCGGCTCGACGTCATCCTCTGCCTCCTCTCCACGCCCGTCTACTTC TTCGCCGCCGACGTCTTCCACGTGCGCGCCGTCAAGGAGCTGCGGTCGCTGTGGCGCGGCGGCAGCCGCACGCCG CTGCTGCAGAGGTTCTACAAGTTCGGCAGCATGAACATGCTCATCTCGCTGGGGACGAGCATCGCCTACATCTCG TCGGTGGCCGAGATGATCGCGGTGGCCGTCCGGGGCGACGACGCCCCCGTGCCCGAGGGCCGCTTCTACTTCGAC TCGGTCGTCTTCCTCACCCTCTTCCTGCTCGCCGGCCGGCTGATCGAGGGCTACAGCAAGTCCAAGACGGGCAAC GCCGTCGAGGCGCTGGCCAAGCTGCGGCCGAGCACGGCCCTGCTCGTCGAGCAGGACAAGATGGGCAAGCAGCGG ACGGCGGCGACGCCCATCGACCAGCTGGAGCAGGGCGACGTGATCCGCGTGCCGGGCGGCGCGTCGCCGGCGGCG GACGGCATCGTCGTCGCCGGCGAGACCAACTTTGACGAGTCGAGCCTGACGGGCGAGTCGCGGCCGATCCGCAAG GGGCCCGGGGACGAAGTCTACGCCGGCACCATCAACAAGGCCGACGCGGTGACGGTGCGCGTGACGGGCACGTGC GGCAAGTCGATGCTGGACCAGATCGTCGAGGTGGTGCGCGAGGGCCAGACGAGGCGGGCGCCGGTGGAGCAGATC GCCGACACGCTGACGGCCTACTTCGTGCCCGTCATGACGCTCGTGGCCATGGTGACGTGGGCGGTGTGGATGGCG CTCGCGCTGAGCGGGCGGGTGGACGAGGCGGAGGTGCGGCGGTCGGGCGGGCCGGCGGCGTTCGCCTTCCAGTTC GCCATCGCCGTCTTCGTCGTGGCGTGCCCGTGCGGGCTGGGCCTGGCGGCGCCGACGGCCATCTTCGTCGGGGGC GGGATCGCGGCCCAGCACGGGATCCTGGCCAAGGGCGGGGGCGAGGCACGGGCACGCTGA |
| Gene | >Hirsu2|2006 CTGGGCGCCGGCCTCGTCGCCGCGCTTGACGATGGCGGGGAAGACGGCGCAGGCGACGCGGGCGCCGCGCAGGGA GTCGTCGTCGAGGCCGCCGACGCCGCGCCCGCGCCGCTGCTGCGCGCCACCGTGTCCGTCGGCGGCATGACGTGC GCCGTCTGCGTCAACACCATCACCGACGAGGTCCAGAAGCGGCCGTGGGTCTCGCGCATCGTCGTCAACCTCGTC TCCAACAGCGCGACTGTCGACTTCACCGACCCGGACCGCGCCGCCGACATCGTCGAGGCCATCGAGGACCTCGGC TACGACGCCGTCCTCGACTCCGTCGTCGACCTCCGCCGCCAGCGCCAGTCGGCCGACGAGCGCGAGATGGAGATC CACGTCGACGGCATCTTCTGCCCGCGCTGCCCCGACCGCATCTGCCAGACGCTGCGCAACCTGGACGCGTCCCGC ATCGACATCCTCCAGGAGCCCACCCCGCAGCTGCCCCGGCTCCGGATCCGCTACCGGCCCGAGCTCCCCCGGCTG ACCATCCGCCACATCCTCGGCGCCATCGAGGCCACGGACCCGTCCCTGCGCGCCTCCATCTACCACCCCCCCACG CTCGAGGAGCGGTCCAGGACGATCCGGGCCAAGCACCAGCGCGAGCTCCTGTACCGCGAGCTCCTGACCGGCCTC ATCGCCATCCCGACCTTCGTCCTCGGCATCGTCTACATGAGCCTGGTCGACAAGGACGACCCGACGCGCAAGCAC CTCATGCAGCCCTGGAGGTCGGGCCTGAGCCGGCTCGACGTCATCCTCTGCCTCCTCTCCACGCCCGTCTACTTC TTCGCCGCCGACGTCTTCCACGTGCGCGCCGTCAAGGAGCTGCGGTCGCTGTGGCGCGGCGGCAGCCGCACGCCG CTGCTGCAGAGGTTCTACAAGTTCGGCAGCATGAACATGCTCATCTCGCTGGGGACGAGCATCGCCTACATCTCG TCGGTGGCCGAGATGATCGCGGTGGCCGTCCGGGGCGACGACGCCCCCGTGCCCGAGGGCCGCTTCTACTTCGAC TCGGTCGTCTTCCTCACCCTCTTCCTGCTCGCCGGCCGGCTGATCGAGGGCTACAGCAAGTCCAAGACGGGCAAC GCCGTCGAGGCGCTGGCCAAGCTGCGGCCGAGCACGGCCCTGCTCGTCGAGCAGGACAAGATGGGCAAGCAGCGG ACGGCGGCGACGCCCATCGACCAGCTGGAGCAGGGCGACGTGATCCGCGTGCCGGGCGGCGCGTCGCCGGCGGCG GACGGCATCGTCGTCGCCGGCGAGACCAACTTTGACGAGTCGAGCCTGACGGGCGAGTCGCGGCCGATCCGCAAG GGGCCCGGGGACGAAGTCTACGCCGGCACCATCAACAAGGCCGACGCGGTGACGGTGCGCGTGACGGGCACGTGC GGCAAGTCGATGCTGGACCAGATCGTCGAGGTGGTGCGCGAGGGCCAGACGAGGCGGGCGCCGGTGGAGCAGATC GCCGACACGCTGACGGCCTACTTCGTGCCCGTCATGACGCTCGTGGCCATGGTGACGTGGGCGGTGTGGATGGCG CTCGCGCTGAGCGGGCGGGTGGACGAGGCGGAGGTGCGGCGGTCGGGCGGGCCGGCGGCGTTCGCCTTCCAGTTC GCCATCGCCGTCTTCGTCGTGGCGTGCCCGTGCGGGCTGGGCCTGGCGGCGCCGACGGCCATCTTCGTCGGGGGC GGGATCGCGGCCCAGCACGGGATCCTGGCCAAGGGCGGGGGCGAGGCGTTCGAGAAGGCGAGCAAGATCGACTGC GTCGTCTTCGACAAGACGGGCACGCTGA |