Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2
Gene name
LocationContig_10:4500..5247
Strand-
Gene length (bp)747
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14474 RTC4 RTC4-like domain 1.1E-30 135 245

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5885 0.8689 0.0474 0.0656 0.0732 0.018 0.0397 0.1123 0.0277 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1906
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2858
Ophiocordyceps australis map64 (Brazil) OphauB2|2247
Ophiocordyceps camponoti-floridani Ophcf2|05106
Ophiocordyceps camponoti-rufipedis Ophun1|7504
Ophiocordyceps kimflemingae Ophio5|2777
Ophiocordyceps subramaniannii Hirsu2|2 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2
MPAQVFDLGPGADDDEGDKLRPETRFSEVASDADRTGSLSPPVNVDEEAAQAVQAAAPAAVCPWCGQAVDKALLD
DFSRGRRLNVRLQTKFCEQHRKQAAMETWRARKYPELAWDGLAQRFAAHRAPLLAIVDGAPSHYRHALADRIASG
RARSTRKEGNLNPGYYGPRGFNLMCDYLVAEFGELLRQRAVGDRVIAGRGSAAFIQSVLVAELAVRLIADDMAVS
PDEARAIMEESKALGEMVHDEEV*
Coding >Hirsu2|2
ATGCCGGCGCAGGTTTTCGACCTCGGACCCGGGGCGGACGACGATGAGGGCGACAAACTGCGGCCCGAGACGAGG
TTTTCGGAGGTAGCCTCGGACGCGGACCGGACCGGAAGTCTGTCGCCGCCGGTGAACGTCGATGAGGAGGCTGCA
CAGGCCGTGCAGGCCGCGGCGCCGGCGGCCGTGTGCCCGTGGTGCGGGCAGGCCGTCGACAAGGCGCTGCTGGAC
GACTTCTCGCGGGGCCGGCGGCTCAACGTGCGGCTGCAGACCAAGTTCTGCGAGCAGCACCGGAAGCAGGCGGCG
ATGGAGACGTGGCGGGCGCGCAAGTACCCGGAGCTGGCGTGGGACGGGCTGGCGCAGCGGTTCGCGGCGCACCGG
GCGCCGCTGCTGGCCATCGTCGACGGCGCGCCGTCGCACTACCGGCACGCGCTGGCGGACCGCATCGCGTCCGGG
CGGGCGCGCTCGACGCGCAAGGAGGGCAACCTCAACCCGGGCTACTACGGCCCGCGCGGCTTCAACCTCATGTGC
GACTACCTGGTGGCCGAGTTCGGCGAGCTGCTGCGCCAGCGGGCCGTCGGCGACCGCGTCATCGCCGGCCGCGGC
TCCGCCGCCTTCATCCAGTCCGTCCTGGTGGCCGAGCTGGCCGTCCGGCTCATCGCCGACGACATGGCCGTCTCG
CCCGACGAGGCGCGCGCCATCATGGAGGAGAGCAAGGCGCTCGGCGAGATGGTTCACGACGAGGAGGTCTGA
Transcript >Hirsu2|2
ATGCCGGCGCAGGTTTTCGACCTCGGACCCGGGGCGGACGACGATGAGGGCGACAAACTGCGGCCCGAGACGAGG
TTTTCGGAGGTAGCCTCGGACGCGGACCGGACCGGAAGTCTGTCGCCGCCGGTGAACGTCGATGAGGAGGCTGCA
CAGGCCGTGCAGGCCGCGGCGCCGGCGGCCGTGTGCCCGTGGTGCGGGCAGGCCGTCGACAAGGCGCTGCTGGAC
GACTTCTCGCGGGGCCGGCGGCTCAACGTGCGGCTGCAGACCAAGTTCTGCGAGCAGCACCGGAAGCAGGCGGCG
ATGGAGACGTGGCGGGCGCGCAAGTACCCGGAGCTGGCGTGGGACGGGCTGGCGCAGCGGTTCGCGGCGCACCGG
GCGCCGCTGCTGGCCATCGTCGACGGCGCGCCGTCGCACTACCGGCACGCGCTGGCGGACCGCATCGCGTCCGGG
CGGGCGCGCTCGACGCGCAAGGAGGGCAACCTCAACCCGGGCTACTACGGCCCGCGCGGCTTCAACCTCATGTGC
GACTACCTGGTGGCCGAGTTCGGCGAGCTGCTGCGCCAGCGGGCCGTCGGCGACCGCGTCATCGCCGGCCGCGGC
TCCGCCGCCTTCATCCAGTCCGTCCTGGTGGCCGAGCTGGCCGTCCGGCTCATCGCCGACGACATGGCCGTCTCG
CCCGACGAGGCGCGCGCCATCATGGAGGAGAGCAAGGCGCTCGGCGAGATGGTTCACGACGAGGAGGTCTGA
Gene >Hirsu2|2
ATGCCGGCGCAGGTTTTCGACCTCGGACCCGGGGCGGACGACGATGAGGGCGACAAACTGCGGCCCGAGACGAGG
TTTTCGGAGGTAGCCTCGGACGCGGACCGGACCGGAAGTCTGTCGCCGCCGGTGAACGTCGATGAGGAGGCTGCA
CAGGCCGTGCAGGCCGCGGCGCCGGCGGCCGTGTGCCCGTGGTGCGGGCAGGCCGTCGACAAGGCGCTGCTGGAC
GACTTCTCGCGGGGCCGGCGGCTCAACGTGCGGCTGCAGACCAAGTTCTGCGAGCAGCACCGGAAGCAGGCGGCG
ATGGAGACGTGGCGGGCGCGCAAGTACCCGGAGCTGGCGTGGGACGGGCTGGCGCAGCGGTTCGCGGCGCACCGG
GCGCCGCTGCTGGCCATCGTCGACGGCGCGCCGTCGCACTACCGGCACGCGCTGGCGGACCGCATCGCGTCCGGG
CGGGCGCGCTCGACGCGCAAGGAGGGCAACCTCAACCCGGGCTACTACGGCCCGCGCGGCTTCAACCTCATGTGC
GACTACCTGGTGGCCGAGTTCGGCGAGCTGCTGCGCCAGCGGGCCGTCGGCGACCGCGTCATCGCCGGCCGCGGC
TCCGCCGCCTTCATCCAGTCCGTCCTGGTGGCCGAGCTGGCCGTCCGGCTCATCGCCGACGACATGGCCGTCTCG
CCCGACGAGGCGCGCGCCATCATGGAGGAGAGCAAGGCGCTCGGCGAGATGGTTCACGACGAGGAGGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail