Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1991
Gene name
LocationContig_146:24602..25414
Strand+
Gene length (bp)812
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5377 0.4355 0.2783 0.1421 0.0684 0.1012 0.0987 0.1138 0.1437 0.0005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup84
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1577
Ophiocordyceps australis 1348a (Ghana) OphauG2|2943
Ophiocordyceps australis 1348a (Ghana) OphauG2|5919
Ophiocordyceps australis map64 (Brazil) OphauB2|1448
Ophiocordyceps australis map64 (Brazil) OphauB2|1752
Ophiocordyceps australis map64 (Brazil) OphauB2|1755
Ophiocordyceps australis map64 (Brazil) OphauB2|2666
Ophiocordyceps australis map64 (Brazil) OphauB2|4190
Ophiocordyceps australis map64 (Brazil) OphauB2|4691
Ophiocordyceps australis map64 (Brazil) OphauB2|4872
Ophiocordyceps australis map64 (Brazil) OphauB2|5124
Ophiocordyceps australis map64 (Brazil) OphauB2|7730
Ophiocordyceps kimflemingae Ophio5|7512
Ophiocordyceps subramaniannii Hirsu2|1991 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4897
Ophiocordyceps subramaniannii Hirsu2|7175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1991
MAAVCKLGQLILDYESAVKDLEKAARLRYNGWNQRYNIIRDYFESDEFKSTLQNRATLEFAASIFALSDLRAWLY
AGKIQAKRKTTTDGESQRVDKKFGARWLQGLRIGCLHIQNTATRFATEIPHEVGEWVKKEHENFTHEFAATYLAT
VKERWRLREVENVPDEAVIYGHLFKQAGAVDTDEIFRIVQDAAKTIPTDQGLCSEPLEELPELPKDPEPTIKEGI
RRDGRKVVVIAYVQNIAHIHT*
Coding >Hirsu2|1991
ATGGCGGCTGTTTGCAAGTTGGGCCAGCTCATCCTTGACTATGAGAGTGCCGTCAAGGACTTGGAAAAAGCAGCG
AGATTGCGATACAACGGGTGGAACCAGAGATATAATATCATCAGGGATTATTTCGAGTCGGACGAATTCAAGTCT
ACTCTGCAGAACCGAGCCACCCTAGAATTTGCGGCTTCCATATTCGCGCTGTCGGATCTCCGCGCCTGGCTGTAT
GCTGGCAAGATCCAGGCCAAAAGGAAGACCACCACCGATGGGGAGAGCCAGAGAGTTGACAAGAAATTCGGCGCC
CGCTGGCTCCAGGGCTTACGGATAGGGTGTCTGCATATTCAGAACACAGCCACTCGCTTCGCCACCGAGATTCCG
CACGAGGTGGGCGAGTGGGTGAAGAAGGAACACGAGAACTTTACTCATGAATTTGCTGCGACGTACCTCGCAACC
GTGAAGGAACGCTGGCGGCTCCGTGAAGTAGAGAACGTTCCTGATGAAGCCGTCATCTACGGTCACCTCTTCAAG
CAAGCCGGAGCCGTCGACACGGACGAAATTTTCCGCATCGTACAGGACGCTGCCAAGACTATTCCGACCGACCAA
GGCCTATGTTCAGAACCTCTTGAGGAGTTGCCCGAGCTGCCGAAGGACCCAGAGCCTACAATAAAGGAGGGTATT
CGGCGCGACGGCCGGAAGGTGGTCGTAATTGCGTACGTCCAAAATATTGCCCATATTCATACATGA
Transcript >Hirsu2|1991
ATGGCGGCTGTTTGCAAGTTGGGCCAGCTCATCCTTGACTATGAGAGTGCCGTCAAGGACTTGGAAAAAGCAGCG
AGATTGCGATACAACGGGTGGAACCAGAGATATAATATCATCAGGGATTATTTCGAGTCGGACGAATTCAAGTCT
ACTCTGCAGAACCGAGCCACCCTAGAATTTGCGGCTTCCATATTCGCGCTGTCGGATCTCCGCGCCTGGCTGTAT
GCTGGCAAGATCCAGGCCAAAAGGAAGACCACCACCGATGGGGAGAGCCAGAGAGTTGACAAGAAATTCGGCGCC
CGCTGGCTCCAGGGCTTACGGATAGGGTGTCTGCATATTCAGAACACAGCCACTCGCTTCGCCACCGAGATTCCG
CACGAGGTGGGCGAGTGGGTGAAGAAGGAACACGAGAACTTTACTCATGAATTTGCTGCGACGTACCTCGCAACC
GTGAAGGAACGCTGGCGGCTCCGTGAAGTAGAGAACGTTCCTGATGAAGCCGTCATCTACGGTCACCTCTTCAAG
CAAGCCGGAGCCGTCGACACGGACGAAATTTTCCGCATCGTACAGGACGCTGCCAAGACTATTCCGACCGACCAA
GGCCTATGTTCAGAACCTCTTGAGGAGTTGCCCGAGCTGCCGAAGGACCCAGAGCCTACAATAAAGGAGGGTATT
CGGCGCGACGGCCGGAAGGTGGTCGTAATTGCGTACGTCCAAAATATTGCCCATATTCATACATGA
Gene >Hirsu2|1991
ATGGCGGCTGTTTGCAAGTTGGGCCAGCTCATCCTTGACTATGAGAGTGCCGTCAAGGACTTGGAAAAAGCAGCG
AGATTGCGATACAACGGGTGGAACCAGAGATATAATATCATCAGGGATTATTTCGAGTCGGACGAATTCAAGTCT
ACTCTGCAGAACCGAGCCACCCTAGAATTTGCGGCTTCCATATTCGCGCTGTCGGATCTCCGCGCCTGGCTGTAT
GCTGGCAAGATCCAGGCCAAAAGGAAGACCACCACCGATGGGGAGAGCCAGAGAGTTGACAAGAAATTCGGCGCC
CGCTGGCTCCAGGGCTTACGGATAGGGTGTCTGCATATTCAGAACACAGCCACTCGCTTCGCCACCGAGATTCCG
CACGAGGTGGGCGAGTGGGTGAAGAAGGAACACGAGAACTTTACTCATGAATTTGCTGCGACGTACCTCGCAACC
GTGAAGGAACGCTGGCGGCTCCGTGAAGTAGAGAACGTTCCTGATGAAGCCGTCATCTACGGTCACCTCTTCAAG
CAAGCCGGAGCCGTCGACACGGACGAAATTTTCCGCATCGTACAGGACGCTGCCAAGACTATTCCGACCGACCAA
GGCCTATGTTCAGAACCTCTTGAGGAGTTGCCCGAGCTGCCGAAGGACCCAGAGCCTACAATAAAGGAGGGTATT
CGGCGCGACGGCCGGAAGGTGGTCGTAATTGCGGTTTGCGCCAAATCTCACGTCGAGTCAGTTGCCGATTGTCCC
CTCGTTCTGAATCATGAAGGGAAGTGCAGTACGTCCAAAATATTGCCCATATTCATACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail