Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1981
Gene name
LocationContig_1459:660..1384
Strand+
Gene length (bp)724
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase 7.5E-15 12 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q80ZM8|CRLS1_MOUSE Cardiolipin synthase (CMP-forming) OS=Mus musculus GN=Crls1 PE=1 SV=1 2 202 1.0E-43
sp|Q5U2V5|CRLS1_RAT Cardiolipin synthase (CMP-forming) OS=Rattus norvegicus GN=Crls1 PE=2 SV=1 2 202 3.0E-43
sp|Q07560|CRD1_YEAST Cardiolipin synthase (CMP-forming) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRD1 PE=1 SV=1 2 202 9.0E-43
sp|Q9UJA2|CRLS1_HUMAN Cardiolipin synthase (CMP-forming) OS=Homo sapiens GN=CRLS1 PE=1 SV=1 2 202 4.0E-42
sp|O13899|YF38_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.08c PE=3 SV=1 5 146 4.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q80ZM8|CRLS1_MOUSE Cardiolipin synthase (CMP-forming) OS=Mus musculus GN=Crls1 PE=1 SV=1 2 202 1.0E-43
sp|Q5U2V5|CRLS1_RAT Cardiolipin synthase (CMP-forming) OS=Rattus norvegicus GN=Crls1 PE=2 SV=1 2 202 3.0E-43
sp|Q07560|CRD1_YEAST Cardiolipin synthase (CMP-forming) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRD1 PE=1 SV=1 2 202 9.0E-43
sp|Q9UJA2|CRLS1_HUMAN Cardiolipin synthase (CMP-forming) OS=Homo sapiens GN=CRLS1 PE=1 SV=1 2 202 4.0E-42
sp|O13899|YF38_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.08c PE=3 SV=1 5 146 4.0E-41
sp|Q8MZC4|CRLS1_DROME Probable cardiolipin synthase (CMP-forming) OS=Drosophila melanogaster GN=CLS PE=2 SV=1 6 202 7.0E-41
sp|O01916|CRLS1_CAEEL Probable cardiolipin synthase (CMP-forming) OS=Caenorhabditis elegans GN=crls-1 PE=3 SV=1 5 200 1.0E-33
sp|Q93YW7|CLS_ARATH Cardiolipin synthase (CMP-forming), mitochondrial OS=Arabidopsis thaliana GN=CLS PE=1 SV=1 8 202 2.0E-23
sp|Q5N9A1|PGPS1_ORYSJ CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0789100 PE=2 SV=1 7 199 1.0E-18
sp|Q68XS5|PGSA_RICTY CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=pgsA PE=3 SV=1 12 191 1.0E-12
sp|Q9ZE96|PGSA_RICPR CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=pgsA PE=3 SV=1 12 191 1.0E-12
sp|Q1RKM3|PGSA_RICBR CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Rickettsia bellii (strain RML369-C) GN=pgsA PE=3 SV=1 12 191 1.0E-12
sp|Q3IYX7|PGSA_RHOS4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pgsA PE=3 SV=1 11 97 2.0E-12
sp|Q4UN77|PGSA_RICFE CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pgsA PE=3 SV=1 12 191 2.0E-11
sp|Q92JJ2|PGSA_RICCN CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=pgsA PE=3 SV=1 12 191 2.0E-11
sp|Q7VR12|PGSA_BLOFL CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Blochmannia floridanus GN=pgsA PE=3 SV=1 6 96 2.0E-11
sp|P63754|PGSA_MYCBO Putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pgsA2 PE=3 SV=1 1 106 4.0E-11
sp|P9WPG5|PGSA1_MYCTU Putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pgsA1 PE=1 SV=1 1 106 4.0E-11
sp|P9WPG4|PGSA1_MYCTO Putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pgsA1 PE=3 SV=1 1 106 4.0E-11
sp|Q492P7|PGSA_BLOPB CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=pgsA PE=3 SV=1 9 80 7.0E-11
sp|Q7CQB9|PGSA_SALTY CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pgsA PE=3 SV=3 11 85 2.0E-10
sp|Q8XFD0|PGSA_SALTI CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella typhi GN=pgsA PE=3 SV=3 11 85 2.0E-10
sp|Q5PI18|PGSA_SALPA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pgsA PE=3 SV=3 11 85 2.0E-10
sp|Q57N57|PGSA_SALCH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pgsA PE=3 SV=3 11 85 2.0E-10
sp|Q322L9|PGSA_SHIBS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pgsA PE=3 SV=3 11 85 3.0E-10
sp|P9WPG3|PGSA2_MYCTU Putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pgsA2 PE=1 SV=1 10 110 3.0E-10
sp|P9WPG2|PGSA2_MYCTO Putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pgsA2 PE=3 SV=1 10 110 3.0E-10
sp|Q3Z2T6|PGSA_SHISS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella sonnei (strain Ss046) GN=pgsA PE=3 SV=3 11 85 3.0E-10
sp|Q32HD9|PGSA_SHIDS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pgsA PE=3 SV=3 11 85 3.0E-10
sp|Q1RAM8|PGSA_ECOUT CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=pgsA PE=3 SV=1 11 85 3.0E-10
sp|P0ABF8|PGSA_ECOLI CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli (strain K12) GN=pgsA PE=1 SV=2 11 85 3.0E-10
sp|P0ABF9|PGSA_ECOL6 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pgsA PE=3 SV=2 11 85 3.0E-10
sp|Q0TGS6|PGSA_ECOL5 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pgsA PE=3 SV=1 11 85 3.0E-10
sp|A1AC64|PGSA_ECOK1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O1:K1 / APEC GN=pgsA PE=3 SV=1 11 85 3.0E-10
sp|P0ABG0|PGSA_ECO57 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O157:H7 GN=pgsA PE=3 SV=2 11 85 3.0E-10
sp|Q83R47|PGSA_SHIFL CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella flexneri GN=pgsA PE=3 SV=3 11 85 3.0E-10
sp|Q0T3L5|PGSA_SHIF8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=pgsA PE=3 SV=1 11 85 3.0E-10
sp|A1JLU9|PGSA_YERE8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pgsA PE=3 SV=1 12 192 4.0E-10
sp|Q6D364|PGSA_PECAS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pgsA PE=3 SV=3 11 77 3.0E-09
sp|Q2NTS8|PGSA_SODGM CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pgsA PE=3 SV=1 12 192 4.0E-09
sp|O67908|PGSA_AQUAE CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Aquifex aeolicus (strain VF5) GN=pgsA PE=3 SV=1 12 114 2.0E-08
sp|P44528|PGSA_HAEIN CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pgsA PE=3 SV=1 11 80 2.0E-08
sp|Q8D2N9|PGSA_WIGBR CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Wigglesworthia glossinidia brevipalpis GN=pgsA PE=3 SV=1 12 77 9.0E-08
sp|Q66BN4|PGSA_YERPS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pgsA PE=3 SV=1 12 77 2.0E-07
sp|A4TK40|PGSA_YERPP CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis (strain Pestoides F) GN=pgsA PE=3 SV=1 12 77 2.0E-07
sp|Q1CHE5|PGSA_YERPN CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pgsA PE=3 SV=1 12 77 2.0E-07
sp|Q8ZF51|PGSA_YERPE CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis GN=pgsA PE=3 SV=1 12 77 2.0E-07
sp|Q1C8L0|PGSA_YERPA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pgsA PE=3 SV=1 12 77 2.0E-07
sp|Q8H8U0|CLS_ORYSJ Cardiolipin synthase (CMP-forming), mitochondrial OS=Oryza sativa subsp. japonica GN=Os03g0283600 PE=2 SV=1 17 192 2.0E-07
sp|P46322|PGSA_BACSU CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Bacillus subtilis (strain 168) GN=pgsA PE=3 SV=3 10 105 6.0E-07
sp|Q7N5C8|PGSA_PHOLL CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pgsA PE=3 SV=1 12 192 6.0E-07
sp|P63757|PGSA_STAAW CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Staphylococcus aureus (strain MW2) GN=pgsA PE=3 SV=1 12 105 1.0E-06
sp|Q6G9T0|PGSA_STAAS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=pgsA PE=3 SV=1 12 105 1.0E-06
sp|Q6GHF2|PGSA_STAAR CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=pgsA PE=3 SV=1 12 105 1.0E-06
sp|P63756|PGSA_STAAN CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Staphylococcus aureus (strain N315) GN=pgsA PE=1 SV=1 12 105 1.0E-06
sp|P63755|PGSA_STAAM CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pgsA PE=3 SV=1 12 105 1.0E-06
sp|Q5HGE8|PGSA_STAAC CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Staphylococcus aureus (strain COL) GN=pgsA PE=3 SV=1 12 105 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016780 phosphotransferase activity, for other substituted phosphate groups Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0006644 phospholipid metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 36 58 22
3 79 101 22
4 172 194 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1981
MSSAPQHEDIYNIPNFLTLTRLAAAPAIGYLVLHDAPAWALGFFAYAAVTDVLDGWVARRWNRKTVVGTVIDPMA
DKALITILTVCLAVKGVLPVWLAGIILGRDAGLGVAAIYYRWISLPPPKTLARYWNFSLPSAEVHPTAISKYNTF
LQLILVGAATAAPLVDADISSAIAVLQYIVATTTVWSGMSYIISKDAVKIIK*
Coding >Hirsu2|1981
ATGTCTTCTGCTCCCCAACACGAAGACATATACAACATTCCTAACTTCCTCACCCTTACGAGGCTCGCGGCAGCC
CCTGCTATCGGCTACCTTGTTTTGCACGACGCCCCGGCTTGGGCGCTTGGATTTTTCGCCTACGCCGCCGTGACC
GATGTGTTGGACGGCTGGGTTGCCCGCCGCTGGAACCGCAAGACGGTTGTTGGTACTGTCATCGACCCCATGGCG
GACAAGGCGCTCATCACCATTCTGACGGTCTGCTTGGCTGTGAAGGGTGTCCTCCCGGTCTGGCTAGCAGGAATC
ATACTGGGCAGAGATGCAGGCTTGGGTGTGGCTGCCATCTACTACCGCTGGATTTCTCTACCCCCCCCTAAGACT
CTTGCGCGCTACTGGAATTTCTCCCTACCCTCGGCAGAGGTGCATCCGACCGCCATCAGTAAATACAACACTTTT
CTCCAGCTGATTCTTGTCGGCGCCGCCACCGCTGCGCCACTTGTTGACGCTGATATATCGTCGGCTATCGCAGTC
CTCCAATACATTGTAGCCACGACGACCGTATGGAGCGGTATGAGTTACATCATCAGCAAGGACGCTGTCAAGATT
ATCAAATAA
Transcript >Hirsu2|1981
ATGTCTTCTGCTCCCCAACACGAAGACATATACAACATTCCTAACTTCCTCACCCTTACGAGGCTCGCGGCAGCC
CCTGCTATCGGCTACCTTGTTTTGCACGACGCCCCGGCTTGGGCGCTTGGATTTTTCGCCTACGCCGCCGTGACC
GATGTGTTGGACGGCTGGGTTGCCCGCCGCTGGAACCGCAAGACGGTTGTTGGTACTGTCATCGACCCCATGGCG
GACAAGGCGCTCATCACCATTCTGACGGTCTGCTTGGCTGTGAAGGGTGTCCTCCCGGTCTGGCTAGCAGGAATC
ATACTGGGCAGAGATGCAGGCTTGGGTGTGGCTGCCATCTACTACCGCTGGATTTCTCTACCCCCCCCTAAGACT
CTTGCGCGCTACTGGAATTTCTCCCTACCCTCGGCAGAGGTGCATCCGACCGCCATCAGTAAATACAACACTTTT
CTCCAGCTGATTCTTGTCGGCGCCGCCACCGCTGCGCCACTTGTTGACGCTGATATATCGTCGGCTATCGCAGTC
CTCCAATACATTGTAGCCACGACGACCGTATGGAGCGGTATGAGTTACATCATCAGCAAGGACGCTGTCAAGATT
ATCAAATAA
Gene >Hirsu2|1981
ATGTCTTCTGCTCCCCAACACGAAGACATATACAACATTCCTAACTTCCTCACCCTTACGAGGCTCGCGGCAGCC
CCTGCTATCGGCTACCTTGTTTTGCACGACGCCCCGGCTTGGGCGCTTGGATTTTTCGCCTACGCCGCCGTGACC
GATGTGTTGGACGGCTGGGTTGCCCGCCGCTGGAACCGCAAGACGGTTGTTGGTACTGTCATCGACCCCATGGCG
GACAAGGCGCTCATCACCATTCTGACGGTCTGCTTGGCTGTGAAGGGTGTCCTCCCGGGTGCGTCGATTCGGTCC
CAAAGGCTGCATTTGAACCCGACTAACATGCTACCCAAGTCTGGCTAGCAGGAATCATACTGGGCAGAGATGCAG
GCTTGGGTGTGGCTGCCATCTACTACCGCTGGATTTCTCTACCCCCCCCTAAGACTCTTGCGCGCTACTGGAATT
TCTCCCTACCCTCGGCAGAGGTGCATCCGACCGCCATCAGTAAATACAACACTTTTCTCCAGCTGATTCTTGTCG
GCGCCGCCACCGCTGCGCCACTTGTTGACGCTGATATATCGTCGGCTATCGCAGTCCTCCAGTGAGTACCCGAAA
CTGCCAAGCAATGATGATGCAGCCCTTTGCTAACCAGTGAGCCAGATACATTGTAGCCACGACGACCGTATGGAG
CGGTATGAGTTACATCATCAGCAAGGACGCTGTCAAGATTATCAAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail