Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1978
Gene name
LocationContig_1457:4526..5601
Strand-
Gene length (bp)1075
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 9.3E-49 73 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13752|YF22_SCHPO Uncharacterized TLC domain-containing protein C17A2.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.02c PE=3 SV=1 13 294 1.0E-61
sp|P47153|TDA4_YEAST Topoisomerase I damage affected protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA4 PE=1 SV=1 32 299 1.0E-25
sp|Q06107|YP114_YEAST Uncharacterized TLC domain-containing protein YPR114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR114W PE=1 SV=1 61 298 6.0E-14
sp|Q96MV1|TMM56_HUMAN Transmembrane protein 56 OS=Homo sapiens GN=TMEM56 PE=1 SV=1 43 215 6.0E-11
sp|Q5XIY2|TM56B_DANRE Transmembrane protein 56-B OS=Danio rerio GN=tmem56b PE=2 SV=1 36 215 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13752|YF22_SCHPO Uncharacterized TLC domain-containing protein C17A2.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.02c PE=3 SV=1 13 294 1.0E-61
sp|P47153|TDA4_YEAST Topoisomerase I damage affected protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA4 PE=1 SV=1 32 299 1.0E-25
sp|Q06107|YP114_YEAST Uncharacterized TLC domain-containing protein YPR114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR114W PE=1 SV=1 61 298 6.0E-14
sp|Q96MV1|TMM56_HUMAN Transmembrane protein 56 OS=Homo sapiens GN=TMEM56 PE=1 SV=1 43 215 6.0E-11
sp|Q5XIY2|TM56B_DANRE Transmembrane protein 56-B OS=Danio rerio GN=tmem56b PE=2 SV=1 36 215 5.0E-10
sp|Q8CGF5|TMM56_MOUSE Transmembrane protein 56 OS=Mus musculus GN=Tmem56 PE=2 SV=1 63 216 1.0E-09
sp|Q6PGS5|TM56B_XENLA Transmembrane protein 56-B OS=Xenopus laevis GN=tmem56-b PE=2 SV=1 30 215 3.0E-08
sp|Q55BP8|TM56C_DICDI Transmembrane protein 56 homolog B OS=Dictyostelium discoideum GN=tmem56c PE=3 SV=1 58 226 1.0E-07
sp|Q6P4N1|TMM56_XENTR Transmembrane protein 56 OS=Xenopus tropicalis GN=tmem56 PE=2 SV=1 63 299 3.0E-07
sp|Q550S9|TM56B_DICDI Transmembrane protein 56 homolog B OS=Dictyostelium discoideum GN=tmem56b PE=3 SV=1 68 299 1.0E-06
sp|Q6GLX2|TM56A_XENLA Transmembrane protein 56-A OS=Xenopus laevis GN=tmem56-a PE=2 SV=1 63 299 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 78 97 19
3 112 134 22
4 141 160 19
5 165 187 22
6 200 218 18
7 258 280 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1978
MRDPFFIAPIPFLVDWVQPWCERLHLPSLPLHIHEVLAAALLYSVIFYPCSPIISNLLAPHHYPRLSRKKKLNWD
AHVVSLVQSTLINCLALWVMAVDEDRRYMGWQERVWGYTGASGMIQALAAGYFVWDLIVTSCNLDVFGFGTLAHA
IAALLVYTLGFRPFVNYYSCIFILWELSTPFLNIHWFMDKVEMTGSRAQLFNGFLLLFSFFSCRLVYGTYQSITV
FRDIWMAIDNHPGGIPNSSVAMAFVTENTTVPLWLAAVYLSSNLTLNTLNFYWFVMMIRAVRKRFEPAKAPQKER
LIEVEVKPCASVSSISCGPNLQRRKHDGSL*
Coding >Hirsu2|1978
ATGAGAGACCCATTCTTCATTGCTCCGATTCCCTTCCTTGTCGACTGGGTGCAGCCCTGGTGCGAACGTTTGCAT
CTCCCTTCACTACCTCTGCATATTCATGAAGTTTTGGCCGCCGCACTCCTCTACTCGGTCATCTTCTACCCTTGC
TCCCCTATTATCTCCAACTTGCTGGCCCCTCATCACTATCCCAGACTGTCCCGGAAAAAAAAGCTCAATTGGGAC
GCTCACGTTGTATCTCTCGTACAGAGCACTCTGATTAACTGTCTCGCCCTTTGGGTCATGGCAGTTGACGAGGAT
CGCCGCTACATGGGATGGCAAGAGCGAGTCTGGGGCTATACCGGCGCTTCCGGAATGATACAGGCACTGGCTGCT
GGTTACTTCGTCTGGGACTTGATTGTAACCAGCTGCAACCTCGATGTATTCGGCTTTGGCACCCTGGCCCACGCT
ATAGCTGCCTTGCTTGTTTATACTCTCGGCTTCCGACCCTTTGTCAACTACTACAGTTGCATCTTCATCCTCTGG
GAACTCTCTACGCCTTTCCTGAACATTCATTGGTTCATGGACAAGGTCGAAATGACCGGATCCCGCGCCCAACTC
TTCAACGGATTTTTACTCCTGTTCAGCTTTTTCTCCTGCCGTCTTGTTTACGGTACCTACCAATCCATTACAGTC
TTCCGCGACATCTGGATGGCCATTGACAACCACCCCGGAGGAATTCCGAATTCCTCGGTCGCCATGGCTTTCGTG
ACTGAGAACACGACCGTCCCACTTTGGCTTGCTGCCGTTTATCTGTCAAGCAATTTGACCCTCAACACCCTCAAT
TTTTATTGGTTTGTCATGATGATTAGAGCCGTCCGCAAGCGTTTCGAACCAGCAAAAGCACCGCAGAAAGAGCGA
CTGATCGAGGTCGAGGTGAAGCCCTGTGCTTCCGTGTCAAGCATTTCCTGTGGGCCGAACTTGCAAAGGCGCAAG
CACGACGGGAGTCTCTGA
Transcript >Hirsu2|1978
ATGAGAGACCCATTCTTCATTGCTCCGATTCCCTTCCTTGTCGACTGGGTGCAGCCCTGGTGCGAACGTTTGCAT
CTCCCTTCACTACCTCTGCATATTCATGAAGTTTTGGCCGCCGCACTCCTCTACTCGGTCATCTTCTACCCTTGC
TCCCCTATTATCTCCAACTTGCTGGCCCCTCATCACTATCCCAGACTGTCCCGGAAAAAAAAGCTCAATTGGGAC
GCTCACGTTGTATCTCTCGTACAGAGCACTCTGATTAACTGTCTCGCCCTTTGGGTCATGGCAGTTGACGAGGAT
CGCCGCTACATGGGATGGCAAGAGCGAGTCTGGGGCTATACCGGCGCTTCCGGAATGATACAGGCACTGGCTGCT
GGTTACTTCGTCTGGGACTTGATTGTAACCAGCTGCAACCTCGATGTATTCGGCTTTGGCACCCTGGCCCACGCT
ATAGCTGCCTTGCTTGTTTATACTCTCGGCTTCCGACCCTTTGTCAACTACTACAGTTGCATCTTCATCCTCTGG
GAACTCTCTACGCCTTTCCTGAACATTCATTGGTTCATGGACAAGGTCGAAATGACCGGATCCCGCGCCCAACTC
TTCAACGGATTTTTACTCCTGTTCAGCTTTTTCTCCTGCCGTCTTGTTTACGGTACCTACCAATCCATTACAGTC
TTCCGCGACATCTGGATGGCCATTGACAACCACCCCGGAGGAATTCCGAATTCCTCGGTCGCCATGGCTTTCGTG
ACTGAGAACACGACCGTCCCACTTTGGCTTGCTGCCGTTTATCTGTCAAGCAATTTGACCCTCAACACCCTCAAT
TTTTATTGGTTTGTCATGATGATTAGAGCCGTCCGCAAGCGTTTCGAACCAGCAAAAGCACCGCAGAAAGAGCGA
CTGATCGAGGTCGAGGTGAAGCCCTGTGCTTCCGTGTCAAGCATTTCCTGTGGGCCGAACTTGCAAAGGCGCAAG
CACGACGGGAGTCTCTGA
Gene >Hirsu2|1978
ATGAGAGACCCATTCTTCATTGCTCCGATTCCCTTCCTTGTCGACTGGGTGCAGCCCTGGTGCGAACGTTTGCAT
CTCCCTTCACTACCTCTGCATATTCATGAAGTTTTGGCCGCCGCACTCCTCTACTCGGTCATCTTCTACCCTTGC
TCCCCTATTATCTCCAACTTGCTGGCCCCTCATCACTATCCCAGACTGTCCCGGAAAAAAAAGCTCAATTGGGAC
GCTCACGTTGTATCTCTCGTACAGAGCACTCTGATTAACTGTCTCGCCCTTTGGGTCATGGCAGTTGACGAGGAT
CGCCGCTACATGGGATGGCAAGAGCGAGTCTGGGGCTATACCGGCGCTTCCGGAATGATACAGGCACTGGCTGCT
GGTTACTTCGTCTGGGACTTGATTGTAACCAGCTGCAACCTCGATGTATTCGGCTTTGGCACCCTGGCCCACGCT
ATAGCTGCCTTGCTTGTTTATACTCTCGGCTTCGTATGCTCCTTTCCCTCCTTGTTTCTGCCCGGCGAAACCCCC
ATTCGCATCTCGTGGTAGCTAGCCGGCTAATAAGCAGCAGCGACCCTTTGTCAACTACTACAGTTGCATCTTCAT
CCTCTGGGAACTCTCTACGCCTTTCCTGAACATTCATTGGTTCATGGACAAGGTCGAAATGACCGGATCCCGCGC
CCAACTCTTCAACGGATTTTTACTCCTGTTCAGCTTTTTCTCCTGCCGTCTTGTTTACGGTACCTACCAATCCAT
TACAGTCTTCCGCGACATCTGGATGGCCATTGACAACCACCCCGGAGGAATTCCGAATTCCTCGGTCGCCATGGC
TTTCGTGACTGAGAACACGACCGTCCCACTTTGGCTTGCTGCCGTTTATCTGTCAAGCAATTTGACCCTCAACAC
CCTCAATTTTTATTGGTTTGTCATGATGATTAGAGCCGTCCGCAAGCGTTTCGAACCAGCAAAAGCACCGCAGAA
AGAGCGACTGATCGAGGTCGAGGTGAAGCCCTGTGCTTCCGTGTCAAGCATTTCCTGTGGGCCGAACTTGCAAAG
GCGCAAGCACGACGGGAGTCTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail