Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1957
Gene name
LocationContig_145:28315..28929
Strand-
Gene length (bp)614
Transcript length (bp)441
Coding sequence length (bp)441
Protein length (aa) 147

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 1 126 1.0E-13
sp|P0CF19|YO162_YEAST Putative uncharacterized transporter YOL162W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL162W PE=5 SV=1 28 126 3.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 58 77 19
3 84 103 19
4 113 135 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1957
MHKREPVTPKLLWQSLKDYDLWPLYLFGLLFQIPMTPPQQYLTLTLRGLGFNTFQTNLLAIPYTILHTTTMLGLA
YLSEATCQLALVAMLGQVWAFPPLIYMNAVNTAVVNKWAVWAVVSLLLGYPNGMATLPIRDQFGPDMETMN*
Coding >Hirsu2|1957
ATGCATAAACGAGAGCCCGTCACCCCGAAACTGCTGTGGCAGAGCCTCAAGGACTATGACCTATGGCCGCTGTAT
CTCTTTGGACTCTTGTTCCAGATCCCGATGACGCCGCCGCAGCAGTATCTCACACTAACCCTTCGAGGGCTCGGC
TTCAACACGTTCCAGACAAATCTGCTGGCCATTCCCTACACCATCCTGCACACCACCACAATGCTTGGCCTGGCA
TACTTGTCCGAGGCAACGTGCCAGCTCGCCCTCGTCGCCATGCTGGGCCAGGTCTGGGCCTTTCCACCTCTGATC
TACATGAACGCCGTGAACACGGCCGTCGTCAACAAGTGGGCCGTCTGGGCCGTCGTCTCCCTTCTCCTGGGCTAC
CCAAACGGTATGGCCACTTTGCCGATACGTGATCAGTTCGGCCCAGACATGGAGACAATGAACTGA
Transcript >Hirsu2|1957
ATGCATAAACGAGAGCCCGTCACCCCGAAACTGCTGTGGCAGAGCCTCAAGGACTATGACCTATGGCCGCTGTAT
CTCTTTGGACTCTTGTTCCAGATCCCGATGACGCCGCCGCAGCAGTATCTCACACTAACCCTTCGAGGGCTCGGC
TTCAACACGTTCCAGACAAATCTGCTGGCCATTCCCTACACCATCCTGCACACCACCACAATGCTTGGCCTGGCA
TACTTGTCCGAGGCAACGTGCCAGCTCGCCCTCGTCGCCATGCTGGGCCAGGTCTGGGCCTTTCCACCTCTGATC
TACATGAACGCCGTGAACACGGCCGTCGTCAACAAGTGGGCCGTCTGGGCCGTCGTCTCCCTTCTCCTGGGCTAC
CCAAACGGTATGGCCACTTTGCCGATACGTGATCAGTTCGGCCCAGACATGGAGACAATGAACTGA
Gene >Hirsu2|1957
ATGCATAAACGAGAGCCCGTCACCCCGAAACTGCTGTGGCAGAGCCTCAAGGACTATGACCTATGGTAAGGGAGG
AGAGCTCCAACGGGACAAGCGATGTGGAATTCGGCGTGTCAATCATCAAAGTTGCCGTGCGGCTAACCGTCTTGC
GTCTCTCGAGGCCGCTGTATCTCTTTGGACTCTTGTTCCAGATCCCGATGACGCCGCCGCAGCAGTATCTCACAC
TAACCCTTCGAGGGCTCGGCTTCAACACGTTCCAGACAAATCTGCTGGCCATTCCCTACACCATCCTGCACAGTA
AGCCCCAACCCGAACGATCTTCCGGAGACTTCTGTACGTGGGCGGTTGCTAAACGCTGGCCTGACACACGTGCAG
CCACCACAATGCTTGGCCTGGCATACTTGTCCGAGGCAACGTGCCAGCTCGCCCTCGTCGCCATGCTGGGCCAGG
TCTGGGCCTTTCCACCTCTGATCTACATGAACGCCGTGAACACGGCCGTCGTCAACAAGTGGGCCGTCTGGGCCG
TCGTCTCCCTTCTCCTGGGCTACCCAAACGGTATGGCCACTTTGCCGATACGTGATCAGTTCGGCCCAGACATGG
AGACAATGAACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail