Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1942
Gene name
LocationContig_1445:858..3800
Strand-
Gene length (bp)2942
Transcript length (bp)2871
Coding sequence length (bp)2871
Protein length (aa) 957

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 2.5E-106 199 711
PF14558 TRP_N ML-like domain 9.6E-39 54 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 34 465 2.0E-44
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 54 746 3.0E-23
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 62 627 3.0E-21
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 64 627 3.0E-20
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 62 687 8.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 34 465 2.0E-44
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 54 746 3.0E-23
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 62 627 3.0E-21
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 64 627 3.0E-20
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 62 687 8.0E-19
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 66 274 6.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 123 145 22
3 202 224 22
4 231 253 22
5 386 408 22
6 429 451 22
7 466 488 22
8 579 601 22
9 605 622 17
10 634 655 21
11 670 692 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1942
MAPASIRFFSLLPPLLSLLLCCLPLAFADDKVYIKGNGIDGVTRQLDVSRYPALYTGDFDDCLGGESLFNVTKFD
AAYYADNLTVLFHLDGTSNIRRENLVLHISVDAYGQNRFNMTYDPCKANIASMCPLNSSVPVTAFVTIPISPTDV
AGIPSIALGIPDLEGFARLQIFANSTQTEIGCFQAVMTNGNSFSQPKAVGTITGVLTLFAALASFATATYGLSIT
HMRVHYAHSFSVLVVLETFQSIFFSGALSVNWPSVLPAWWSNFAWSAGMFANRQIVGSLSSFTGNNANASQVGGA
GSVPINNGGGLLRQIYGRSLSEASGRANDEMHTILPRADFNASNPYDYNWNGHPRIPGMPMPGTWPGFGGTLSVV
DVPPAEAFMVGLIWLLVVLGLVALFVVVTKLLLDFFARIKLVQTDGFDYFRTHLGGYLISALLRTLFIAFFTIMT
LAMYQFSLRGSAGPTAIAVVVWLLFFFGVGGAAFYACYARLRDGDFEAAPDTVRLERGTLFKKVPFIAATRASRI
GEQETAEKPFLFGTMPFLRIKHTNRDPNRATVHQDVGYIKRFGWLTARYRRTRWWFFSVYIGYLFVRACFIGGGA
RNRLAQVFGLFIFEILALLAIIKMNPFEGNRNTAMAVWMLSISKIATTGLSIAFLPDFSISRIAATVIGIIIIVV
QGFVAVAVLVLIGLGIISSWMSLSRNREKFPASLDEMRIQYFEHLEARSADLPPKPKEAKKKQEEPVERRFDVRG
VRRAPRMEDEGGAPGEPERPGQVAASSAAASIRRSRANSASSRCSVNSMPPRTGRAHRTSWNSKDLAQWDAEMNR
GDVQRGSHSRSGSLRLKGINHDSHGNGSPARRPPMTPMLESFEGPTWGIPAKATESAISGRRDDEKPDPVVEMKP
PAAPSAIKQPVQEEAEAGEQAEPRSADGSPPSNVEASNGATMLLGTTSTKGGEKQG*
Coding >Hirsu2|1942
ATGGCGCCGGCCTCGATCCGCTTCTTCTCCCTCCTCCCGCCGCTACTCTCCTTGCTCCTCTGCTGTCTCCCCCTT
GCCTTCGCCGACGACAAAGTCTACATCAAAGGCAATGGCATCGACGGCGTCACGCGCCAGCTCGACGTCAGTCGC
TATCCTGCCCTTTATACCGGTGACTTCGACGACTGTCTTGGCGGAGAGAGCTTGTTCAACGTCACCAAATTCGAT
GCCGCCTACTATGCCGACAACCTCACCGTCCTCTTCCACCTCGACGGCACCAGCAACATCAGGAGGGAAAATCTT
GTCCTCCACATCTCCGTCGATGCATACGGGCAAAATCGCTTCAACATGACCTACGACCCGTGCAAGGCCAACATC
GCCAGCATGTGCCCGCTCAATAGCAGTGTGCCCGTCACGGCCTTCGTCACGATCCCCATATCGCCCACCGACGTC
GCCGGCATCCCCTCCATTGCTCTCGGCATCCCCGATCTCGAGGGCTTCGCCCGCCTGCAGATATTCGCCAATTCG
ACACAGACCGAGATCGGCTGCTTCCAGGCCGTCATGACCAACGGCAATTCCTTCTCCCAGCCAAAGGCCGTCGGC
ACCATCACCGGCGTCCTGACCTTGTTTGCTGCCCTGGCGTCTTTTGCCACCGCCACCTACGGCTTGAGCATCACG
CACATGCGCGTGCACTATGCTCATTCCTTTTCCGTTCTCGTCGTCCTGGAGACCTTCCAGTCCATCTTCTTCTCC
GGCGCCCTCTCCGTCAACTGGCCCAGCGTCCTCCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCCGGCATGTTC
GCCAACCGCCAGATCGTCGGCTCCTTGAGCTCCTTTACCGGCAACAACGCCAACGCCAGCCAGGTAGGAGGTGCT
GGCTCCGTACCGATCAATAACGGCGGCGGCCTGCTGCGCCAGATTTACGGCCGATCTCTGTCCGAAGCCTCGGGC
CGTGCGAACGACGAGATGCATACCATCCTGCCTCGAGCAGACTTCAACGCGAGCAACCCGTACGACTACAACTGG
AACGGCCACCCTCGGATCCCGGGTATGCCCATGCCCGGGACCTGGCCCGGGTTCGGTGGCACTCTCTCCGTCGTC
GACGTGCCCCCGGCCGAGGCCTTCATGGTCGGCCTGATATGGCTACTCGTCGTCTTGGGTCTTGTCGCCCTGTTT
GTTGTGGTGACAAAGTTACTACTAGACTTTTTCGCGAGGATCAAGTTGGTGCAGACGGACGGCTTCGACTACTTC
CGCACCCACCTTGGTGGATATCTCATCTCTGCCCTGCTGCGGACTCTCTTCATCGCCTTCTTCACCATCATGACC
CTGGCCATGTATCAATTCTCGCTCCGAGGGTCTGCTGGGCCGACGGCCATTGCTGTCGTCGTCTGGCTCCTCTTC
TTCTTTGGAGTCGGCGGAGCAGCTTTCTACGCGTGCTATGCCAGGCTGCGCGACGGAGATTTCGAGGCTGCCCCG
GACACGGTGCGACTGGAGCGCGGGACCCTCTTCAAGAAGGTCCCGTTCATAGCGGCCACGCGAGCCAGTCGGATC
GGGGAGCAGGAGACTGCGGAGAAGCCATTTCTTTTCGGCACGATGCCCTTTCTCAGAATCAAGCACACGAACCGC
GACCCCAACCGAGCGACCGTGCACCAAGACGTCGGATATATCAAGAGATTCGGATGGCTCACGGCACGATACCGG
CGCACGAGATGGTGGTTCTTCTCCGTCTACATCGGCTACCTGTTCGTCAGAGCCTGCTTCATCGGCGGCGGGGCA
CGCAATCGCCTGGCTCAAGTGTTCGGCCTGTTCATCTTCGAGATCCTGGCCCTCCTGGCCATCATCAAGATGAAC
CCGTTCGAGGGCAACCGCAACACGGCCATGGCCGTCTGGATGCTGTCCATATCCAAGATTGCCACGACGGGGCTT
TCGATTGCTTTCCTGCCCGACTTCAGCATCAGCCGCATAGCGGCCACCGTCATCGGAATCATCATCATTGTCGTC
CAAGGCTTCGTCGCCGTGGCTGTTCTGGTCTTGATAGGACTGGGCATCATTTCGAGCTGGATGTCCCTGTCGCGA
AACCGAGAGAAGTTCCCGGCGTCGCTGGATGAGATGCGCATCCAGTATTTCGAGCACCTGGAGGCGCGCTCTGCC
GACCTGCCGCCCAAGCCGAAGGAGGCGAAGAAAAAGCAGGAGGAACCGGTCGAGCGTCGGTTTGACGTTCGAGGC
GTCCGCCGCGCCCCGAGGATGGAAGACGAGGGCGGTGCCCCGGGAGAGCCCGAGCGGCCGGGCCAGGTGGCGGCA
TCGAGCGCCGCGGCCAGCATTCGCCGCAGCCGGGCCAACAGCGCCAGCTCACGCTGTTCGGTCAACAGCATGCCC
CCTCGCACCGGTCGCGCCCACCGCACGTCTTGGAACTCCAAAGACTTGGCGCAGTGGGACGCCGAGATGAACAGA
GGGGACGTGCAGCGCGGGAGCCACTCACGGTCGGGCTCCCTTCGGCTCAAGGGCATCAACCATGACTCTCACGGG
AACGGCTCGCCGGCAAGGAGGCCGCCCATGACTCCCATGCTGGAGTCGTTCGAGGGCCCGACGTGGGGTATCCCC
GCGAAGGCGACAGAAAGCGCCATCAGTGGCCGGCGAGATGACGAGAAGCCGGATCCCGTGGTCGAGATGAAGCCG
CCCGCCGCGCCATCCGCGATCAAGCAGCCCGTACAGGAGGAGGCGGAGGCCGGCGAGCAAGCGGAACCGCGGAGT
GCTGACGGCTCCCCTCCTTCCAACGTGGAGGCTTCGAATGGCGCCACGATGCTCCTGGGTACCACCAGCACGAAG
GGGGGAGAGAAACAGGGCTGA
Transcript >Hirsu2|1942
ATGGCGCCGGCCTCGATCCGCTTCTTCTCCCTCCTCCCGCCGCTACTCTCCTTGCTCCTCTGCTGTCTCCCCCTT
GCCTTCGCCGACGACAAAGTCTACATCAAAGGCAATGGCATCGACGGCGTCACGCGCCAGCTCGACGTCAGTCGC
TATCCTGCCCTTTATACCGGTGACTTCGACGACTGTCTTGGCGGAGAGAGCTTGTTCAACGTCACCAAATTCGAT
GCCGCCTACTATGCCGACAACCTCACCGTCCTCTTCCACCTCGACGGCACCAGCAACATCAGGAGGGAAAATCTT
GTCCTCCACATCTCCGTCGATGCATACGGGCAAAATCGCTTCAACATGACCTACGACCCGTGCAAGGCCAACATC
GCCAGCATGTGCCCGCTCAATAGCAGTGTGCCCGTCACGGCCTTCGTCACGATCCCCATATCGCCCACCGACGTC
GCCGGCATCCCCTCCATTGCTCTCGGCATCCCCGATCTCGAGGGCTTCGCCCGCCTGCAGATATTCGCCAATTCG
ACACAGACCGAGATCGGCTGCTTCCAGGCCGTCATGACCAACGGCAATTCCTTCTCCCAGCCAAAGGCCGTCGGC
ACCATCACCGGCGTCCTGACCTTGTTTGCTGCCCTGGCGTCTTTTGCCACCGCCACCTACGGCTTGAGCATCACG
CACATGCGCGTGCACTATGCTCATTCCTTTTCCGTTCTCGTCGTCCTGGAGACCTTCCAGTCCATCTTCTTCTCC
GGCGCCCTCTCCGTCAACTGGCCCAGCGTCCTCCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCCGGCATGTTC
GCCAACCGCCAGATCGTCGGCTCCTTGAGCTCCTTTACCGGCAACAACGCCAACGCCAGCCAGGTAGGAGGTGCT
GGCTCCGTACCGATCAATAACGGCGGCGGCCTGCTGCGCCAGATTTACGGCCGATCTCTGTCCGAAGCCTCGGGC
CGTGCGAACGACGAGATGCATACCATCCTGCCTCGAGCAGACTTCAACGCGAGCAACCCGTACGACTACAACTGG
AACGGCCACCCTCGGATCCCGGGTATGCCCATGCCCGGGACCTGGCCCGGGTTCGGTGGCACTCTCTCCGTCGTC
GACGTGCCCCCGGCCGAGGCCTTCATGGTCGGCCTGATATGGCTACTCGTCGTCTTGGGTCTTGTCGCCCTGTTT
GTTGTGGTGACAAAGTTACTACTAGACTTTTTCGCGAGGATCAAGTTGGTGCAGACGGACGGCTTCGACTACTTC
CGCACCCACCTTGGTGGATATCTCATCTCTGCCCTGCTGCGGACTCTCTTCATCGCCTTCTTCACCATCATGACC
CTGGCCATGTATCAATTCTCGCTCCGAGGGTCTGCTGGGCCGACGGCCATTGCTGTCGTCGTCTGGCTCCTCTTC
TTCTTTGGAGTCGGCGGAGCAGCTTTCTACGCGTGCTATGCCAGGCTGCGCGACGGAGATTTCGAGGCTGCCCCG
GACACGGTGCGACTGGAGCGCGGGACCCTCTTCAAGAAGGTCCCGTTCATAGCGGCCACGCGAGCCAGTCGGATC
GGGGAGCAGGAGACTGCGGAGAAGCCATTTCTTTTCGGCACGATGCCCTTTCTCAGAATCAAGCACACGAACCGC
GACCCCAACCGAGCGACCGTGCACCAAGACGTCGGATATATCAAGAGATTCGGATGGCTCACGGCACGATACCGG
CGCACGAGATGGTGGTTCTTCTCCGTCTACATCGGCTACCTGTTCGTCAGAGCCTGCTTCATCGGCGGCGGGGCA
CGCAATCGCCTGGCTCAAGTGTTCGGCCTGTTCATCTTCGAGATCCTGGCCCTCCTGGCCATCATCAAGATGAAC
CCGTTCGAGGGCAACCGCAACACGGCCATGGCCGTCTGGATGCTGTCCATATCCAAGATTGCCACGACGGGGCTT
TCGATTGCTTTCCTGCCCGACTTCAGCATCAGCCGCATAGCGGCCACCGTCATCGGAATCATCATCATTGTCGTC
CAAGGCTTCGTCGCCGTGGCTGTTCTGGTCTTGATAGGACTGGGCATCATTTCGAGCTGGATGTCCCTGTCGCGA
AACCGAGAGAAGTTCCCGGCGTCGCTGGATGAGATGCGCATCCAGTATTTCGAGCACCTGGAGGCGCGCTCTGCC
GACCTGCCGCCCAAGCCGAAGGAGGCGAAGAAAAAGCAGGAGGAACCGGTCGAGCGTCGGTTTGACGTTCGAGGC
GTCCGCCGCGCCCCGAGGATGGAAGACGAGGGCGGTGCCCCGGGAGAGCCCGAGCGGCCGGGCCAGGTGGCGGCA
TCGAGCGCCGCGGCCAGCATTCGCCGCAGCCGGGCCAACAGCGCCAGCTCACGCTGTTCGGTCAACAGCATGCCC
CCTCGCACCGGTCGCGCCCACCGCACGTCTTGGAACTCCAAAGACTTGGCGCAGTGGGACGCCGAGATGAACAGA
GGGGACGTGCAGCGCGGGAGCCACTCACGGTCGGGCTCCCTTCGGCTCAAGGGCATCAACCATGACTCTCACGGG
AACGGCTCGCCGGCAAGGAGGCCGCCCATGACTCCCATGCTGGAGTCGTTCGAGGGCCCGACGTGGGGTATCCCC
GCGAAGGCGACAGAAAGCGCCATCAGTGGCCGGCGAGATGACGAGAAGCCGGATCCCGTGGTCGAGATGAAGCCG
CCCGCCGCGCCATCCGCGATCAAGCAGCCCGTACAGGAGGAGGCGGAGGCCGGCGAGCAAGCGGAACCGCGGAGT
GCTGACGGCTCCCCTCCTTCCAACGTGGAGGCTTCGAATGGCGCCACGATGCTCCTGGGTACCACCAGCACGAAG
GGGGGAGAGAAACAGGGCTGA
Gene >Hirsu2|1942
ATGGCGCCGGCCTCGATCCGCTTCTTCTCCCTCCTCCCGCCGCTACTCTCCTTGCTCCTCTGCTGTCTCCCCCTT
GCCTTCGCCGACGACAAAGTCTACATCAAAGGCAATGGCATCGACGGCGTCACGCGCCAGCTCGACGTCAGTCGC
TATCCTGCCCTTTATACCGGTGACTTCGACGACTGTCTTGGCGGAGAGAGCTTGTTCAACGTCACCAAATTCGAT
GCCGCCTACTATGCCGACAACCTCACCGTCCTCTTCCACCTCGACGGCACCAGCAACATCAGGAGGGAAAATCTT
GTCCGTAAGTTGACCCTGTCGCACCTTGCCATCTGCTTGGAACCTGATGGCTGACTTCTGTCGCCCTCGTCTCAG
TCCACATCTCCGTCGATGCATACGGGCAAAATCGCTTCAACATGACCTACGACCCGTGCAAGGCCAACATCGCCA
GCATGTGCCCGCTCAATAGCAGTGTGCCCGTCACGGCCTTCGTCACGATCCCCATATCGCCCACCGACGTCGCCG
GCATCCCCTCCATTGCTCTCGGCATCCCCGATCTCGAGGGCTTCGCCCGCCTGCAGATATTCGCCAATTCGACAC
AGACCGAGATCGGCTGCTTCCAGGCCGTCATGACCAACGGCAATTCCTTCTCCCAGCCAAAGGCCGTCGGCACCA
TCACCGGCGTCCTGACCTTGTTTGCTGCCCTGGCGTCTTTTGCCACCGCCACCTACGGCTTGAGCATCACGCACA
TGCGCGTGCACTATGCTCATTCCTTTTCCGTTCTCGTCGTCCTGGAGACCTTCCAGTCCATCTTCTTCTCCGGCG
CCCTCTCCGTCAACTGGCCCAGCGTCCTCCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCCGGCATGTTCGCCA
ACCGCCAGATCGTCGGCTCCTTGAGCTCCTTTACCGGCAACAACGCCAACGCCAGCCAGGTAGGAGGTGCTGGCT
CCGTACCGATCAATAACGGCGGCGGCCTGCTGCGCCAGATTTACGGCCGATCTCTGTCCGAAGCCTCGGGCCGTG
CGAACGACGAGATGCATACCATCCTGCCTCGAGCAGACTTCAACGCGAGCAACCCGTACGACTACAACTGGAACG
GCCACCCTCGGATCCCGGGTATGCCCATGCCCGGGACCTGGCCCGGGTTCGGTGGCACTCTCTCCGTCGTCGACG
TGCCCCCGGCCGAGGCCTTCATGGTCGGCCTGATATGGCTACTCGTCGTCTTGGGTCTTGTCGCCCTGTTTGTTG
TGGTGACAAAGTTACTACTAGACTTTTTCGCGAGGATCAAGTTGGTGCAGACGGACGGCTTCGACTACTTCCGCA
CCCACCTTGGTGGATATCTCATCTCTGCCCTGCTGCGGACTCTCTTCATCGCCTTCTTCACCATCATGACCCTGG
CCATGTATCAATTCTCGCTCCGAGGGTCTGCTGGGCCGACGGCCATTGCTGTCGTCGTCTGGCTCCTCTTCTTCT
TTGGAGTCGGCGGAGCAGCTTTCTACGCGTGCTATGCCAGGCTGCGCGACGGAGATTTCGAGGCTGCCCCGGACA
CGGTGCGACTGGAGCGCGGGACCCTCTTCAAGAAGGTCCCGTTCATAGCGGCCACGCGAGCCAGTCGGATCGGGG
AGCAGGAGACTGCGGAGAAGCCATTTCTTTTCGGCACGATGCCCTTTCTCAGAATCAAGCACACGAACCGCGACC
CCAACCGAGCGACCGTGCACCAAGACGTCGGATATATCAAGAGATTCGGATGGCTCACGGCACGATACCGGCGCA
CGAGATGGTGGTTCTTCTCCGTCTACATCGGCTACCTGTTCGTCAGAGCCTGCTTCATCGGCGGCGGGGCACGCA
ATCGCCTGGCTCAAGTGTTCGGCCTGTTCATCTTCGAGATCCTGGCCCTCCTGGCCATCATCAAGATGAACCCGT
TCGAGGGCAACCGCAACACGGCCATGGCCGTCTGGATGCTGTCCATATCCAAGATTGCCACGACGGGGCTTTCGA
TTGCTTTCCTGCCCGACTTCAGCATCAGCCGCATAGCGGCCACCGTCATCGGAATCATCATCATTGTCGTCCAAG
GCTTCGTCGCCGTGGCTGTTCTGGTCTTGATAGGACTGGGCATCATTTCGAGCTGGATGTCCCTGTCGCGAAACC
GAGAGAAGTTCCCGGCGTCGCTGGATGAGATGCGCATCCAGTATTTCGAGCACCTGGAGGCGCGCTCTGCCGACC
TGCCGCCCAAGCCGAAGGAGGCGAAGAAAAAGCAGGAGGAACCGGTCGAGCGTCGGTTTGACGTTCGAGGCGTCC
GCCGCGCCCCGAGGATGGAAGACGAGGGCGGTGCCCCGGGAGAGCCCGAGCGGCCGGGCCAGGTGGCGGCATCGA
GCGCCGCGGCCAGCATTCGCCGCAGCCGGGCCAACAGCGCCAGCTCACGCTGTTCGGTCAACAGCATGCCCCCTC
GCACCGGTCGCGCCCACCGCACGTCTTGGAACTCCAAAGACTTGGCGCAGTGGGACGCCGAGATGAACAGAGGGG
ACGTGCAGCGCGGGAGCCACTCACGGTCGGGCTCCCTTCGGCTCAAGGGCATCAACCATGACTCTCACGGGAACG
GCTCGCCGGCAAGGAGGCCGCCCATGACTCCCATGCTGGAGTCGTTCGAGGGCCCGACGTGGGGTATCCCCGCGA
AGGCGACAGAAAGCGCCATCAGTGGCCGGCGAGATGACGAGAAGCCGGATCCCGTGGTCGAGATGAAGCCGCCCG
CCGCGCCATCCGCGATCAAGCAGCCCGTACAGGAGGAGGCGGAGGCCGGCGAGCAAGCGGAACCGCGGAGTGCTG
ACGGCTCCCCTCCTTCCAACGTGGAGGCTTCGAATGGCGCCACGATGCTCCTGGGTACCACCAGCACGAAGGGGG
GAGAGAAACAGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail