Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1938
Gene name
LocationContig_1443:726..1412
Strand-
Gene length (bp)686
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00416 Ribosomal_S13 Ribosomal protein S13/S18 3.0E-56 16 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ISP0|RS18_BRABE 40S ribosomal protein S18 OS=Branchiostoma belcheri GN=RPS18 PE=2 SV=1 1 154 8.0E-87
sp|P0CT67|RS18B_SCHPO 40S ribosomal protein S18-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1802 PE=3 SV=1 1 154 5.0E-86
sp|P0CT66|RS18A_SCHPO 40S ribosomal protein S18-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1801 PE=3 SV=1 1 154 5.0E-86
sp|Q8JGS9|RS18_DANRE 40S ribosomal protein S18 OS=Danio rerio GN=rps18 PE=2 SV=1 1 154 4.0E-84
sp|Q8IT98|RS18_ARGIR 40S ribosomal protein S18 OS=Argopecten irradians GN=RPS18 PE=2 SV=1 1 154 1.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ISP0|RS18_BRABE 40S ribosomal protein S18 OS=Branchiostoma belcheri GN=RPS18 PE=2 SV=1 1 154 8.0E-87
sp|P0CT67|RS18B_SCHPO 40S ribosomal protein S18-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1802 PE=3 SV=1 1 154 5.0E-86
sp|P0CT66|RS18A_SCHPO 40S ribosomal protein S18-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1801 PE=3 SV=1 1 154 5.0E-86
sp|Q8JGS9|RS18_DANRE 40S ribosomal protein S18 OS=Danio rerio GN=rps18 PE=2 SV=1 1 154 4.0E-84
sp|Q8IT98|RS18_ARGIR 40S ribosomal protein S18 OS=Argopecten irradians GN=RPS18 PE=2 SV=1 1 154 1.0E-83
sp|Q962R1|RS18_SPOFR 40S ribosomal protein S18 OS=Spodoptera frugiperda GN=RpS18 PE=2 SV=1 1 154 2.0E-83
sp|Q90YQ5|RS18_ICTPU 40S ribosomal protein S18 OS=Ictalurus punctatus GN=rps18 PE=2 SV=1 1 154 4.0E-83
sp|P62271|RS18_RAT 40S ribosomal protein S18 OS=Rattus norvegicus GN=Rps18 PE=1 SV=3 1 154 1.0E-82
sp|P62272|RS18_PIG 40S ribosomal protein S18 OS=Sus scrofa GN=RPS18 PE=1 SV=3 1 154 1.0E-82
sp|P62270|RS18_MOUSE 40S ribosomal protein S18 OS=Mus musculus GN=Rps18 PE=1 SV=3 1 154 1.0E-82
sp|P62269|RS18_HUMAN 40S ribosomal protein S18 OS=Homo sapiens GN=RPS18 PE=1 SV=3 1 154 1.0E-82
sp|A5JST6|RS18_CAPHI 40S ribosomal protein S18 OS=Capra hircus GN=RPS18 PE=2 SV=1 1 154 1.0E-82
sp|Q5TJE9|RS18_CANLF 40S ribosomal protein S18 OS=Canis lupus familiaris GN=RPS18 PE=1 SV=3 1 154 1.0E-82
sp|Q3T0R1|RS18_BOVIN 40S ribosomal protein S18 OS=Bos taurus GN=RPS18 PE=2 SV=3 1 154 1.0E-82
sp|P0CX56|RS18B_YEAST 40S ribosomal protein S18-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS18B PE=1 SV=1 1 144 2.0E-81
sp|P0CX55|RS18A_YEAST 40S ribosomal protein S18-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS18A PE=1 SV=1 1 144 2.0E-81
sp|P34788|RS18_ARATH 40S ribosomal protein S18 OS=Arabidopsis thaliana GN=RPS18A PE=1 SV=1 1 154 3.0E-80
sp|P41094|RS18_DROME 40S ribosomal protein S18 OS=Drosophila melanogaster GN=RpS18 PE=1 SV=1 1 154 6.0E-79
sp|P49202|RS18_CHLRE 40S ribosomal protein S18 OS=Chlamydomonas reinhardtii GN=RPS18 PE=2 SV=1 2 154 1.0E-72
sp|Q869U7|RS18_DICDI 40S ribosomal protein S18 OS=Dictyostelium discoideum GN=rps18 PE=3 SV=1 11 154 5.0E-71
sp|P48151|RS18_ENTHI 40S ribosomal protein S18 OS=Entamoeba histolytica GN=RPS18 PE=2 SV=1 1 154 1.0E-69
sp|A3DMQ3|RS13_STAMF 30S ribosomal protein S13 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps13 PE=3 SV=1 10 154 2.0E-41
sp|Q8SRP2|RS18_ENCCU 40S ribosomal protein S18 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS18 PE=1 SV=1 7 154 1.0E-40
sp|O74021|RS13_PYRHO 30S ribosomal protein S13 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps13 PE=3 SV=1 9 154 2.0E-40
sp|Q9V1A0|RS13_PYRAB 30S ribosomal protein S13 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps13 PE=3 SV=1 9 154 1.0E-39
sp|Q8U0E2|RS13_PYRFU 30S ribosomal protein S13 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps13 PE=1 SV=1 9 154 3.0E-39
sp|Q8TRR2|RS13_METAC 30S ribosomal protein S13 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps13 PE=3 SV=2 11 154 3.0E-38
sp|O26141|RS13_METTH 30S ribosomal protein S13 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps13 PE=3 SV=1 11 154 4.0E-38
sp|A0B9L1|RS13_METTP 30S ribosomal protein S13 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps13 PE=3 SV=1 10 154 5.0E-38
sp|Q46GC7|RS13_METBF 30S ribosomal protein S13 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps13 PE=3 SV=1 7 154 3.0E-37
sp|Q8PV19|RS13_METMA 30S ribosomal protein S13 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps13 PE=3 SV=1 11 154 4.0E-37
sp|Q0W1V6|RS13_METAR 30S ribosomal protein S13 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps13 PE=3 SV=1 8 155 5.0E-36
sp|Q5JJF1|RS13_THEKO 30S ribosomal protein S13 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps13 PE=3 SV=1 10 154 5.0E-36
sp|A2BK76|RS13_HYPBU 30S ribosomal protein S13 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps13 PE=3 SV=1 10 154 1.0E-34
sp|Q2NFZ3|RS13_METST 30S ribosomal protein S13 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps13 PE=3 SV=1 11 154 3.0E-34
sp|P54019|RS13_METJA 30S ribosomal protein S13 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps13 PE=3 SV=2 7 154 5.0E-34
sp|Q12ZR6|RS13_METBU 30S ribosomal protein S13 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps13 PE=3 SV=1 11 154 5.0E-34
sp|O27999|RS13_ARCFU 30S ribosomal protein S13 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps13 PE=3 SV=1 10 154 8.0E-34
sp|Q6KZP8|RS13_PICTO 30S ribosomal protein S13 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps13 PE=3 SV=1 10 154 1.0E-33
sp|Q9YB60|RS13_AERPE 30S ribosomal protein S13 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps13p PE=3 SV=2 4 154 1.0E-32
sp|Q8TVC1|RS13_METKA 30S ribosomal protein S13 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps13 PE=3 SV=1 14 154 1.0E-32
sp|A5UN52|RS13_METS3 30S ribosomal protein S13 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps13 PE=3 SV=1 10 152 2.0E-32
sp|Q9HJD6|RS13_THEAC 30S ribosomal protein S13 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps13 PE=3 SV=1 7 154 8.0E-32
sp|Q97B96|RS13_THEVO 30S ribosomal protein S13 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps13 PE=3 SV=1 10 154 2.0E-31
sp|Q6LXN1|RS13_METMP 30S ribosomal protein S13 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps13 PE=3 SV=1 8 154 3.0E-29
sp|Q2FT96|RS13_METHJ 30S ribosomal protein S13 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps13 PE=3 SV=1 11 155 8.0E-29
sp|Q74M95|RS13_NANEQ 30S ribosomal protein S13 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps13 PE=3 SV=1 14 154 2.0E-28
sp|A3CWH6|RS13_METMJ 30S ribosomal protein S13 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps13 PE=3 SV=1 7 154 2.0E-28
sp|Q3IQT9|RS13_NATPD 30S ribosomal protein S13 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps13 PE=3 SV=1 7 151 3.0E-28
sp|A1RT04|RS13_PYRIL 30S ribosomal protein S13 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps13 PE=3 SV=1 10 156 7.0E-28
sp|A2SSW0|RS13_METLZ 30S ribosomal protein S13 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps13 PE=3 SV=1 7 154 8.0E-28
sp|A3MUT0|RS13_PYRCJ 30S ribosomal protein S13 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps13 PE=3 SV=1 11 156 4.0E-27
sp|Q8ZTV0|RS13_PYRAE 30S ribosomal protein S13 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps13 PE=3 SV=1 14 156 5.0E-27
sp|A4WM28|RS13_PYRAR 30S ribosomal protein S13 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps13 PE=3 SV=1 10 155 2.0E-26
sp|P95986|RS13_SULSO 30S ribosomal protein S13 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps13 PE=3 SV=1 11 156 2.0E-25
sp|Q00861|RS13_HALMA 30S ribosomal protein S13 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps13 PE=3 SV=1 11 151 3.0E-25
sp|Q9V2W4|RS13_HALSA 30S ribosomal protein S13 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps13 PE=3 SV=1 10 151 4.0E-25
sp|Q96YV7|RS13_SULTO 30S ribosomal protein S13 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps13 PE=3 SV=1 7 138 2.0E-24
sp|A0RY01|RS13_CENSY 30S ribosomal protein S13 OS=Cenarchaeum symbiosum (strain A) GN=rps13 PE=3 SV=1 11 143 3.0E-24
sp|Q18G53|RS13_HALWD 30S ribosomal protein S13 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps13 PE=3 SV=1 11 151 1.0E-23
sp|P39470|RS13_SULAC 30S ribosomal protein S13 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps13 PE=3 SV=2 11 156 1.0E-21
sp|A1RWT9|RS13_THEPD 30S ribosomal protein S13 OS=Thermofilum pendens (strain Hrk 5) GN=rps13 PE=3 SV=1 4 154 1.0E-16
sp|B3DVZ3|RS13_METI4 30S ribosomal protein S13 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsM PE=3 SV=1 16 154 2.0E-15
sp|B3CN47|RS13_WOLPP 30S ribosomal protein S13 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rpsM PE=3 SV=1 16 147 4.0E-14
sp|A6LLN8|RS13_THEM4 30S ribosomal protein S13 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsM PE=3 SV=1 14 143 3.0E-13
sp|B1ZNC6|RS13_OPITP 30S ribosomal protein S13 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpsM PE=3 SV=1 16 151 4.0E-13
sp|B7IHX0|RS13_THEAB 30S ribosomal protein S13 OS=Thermosipho africanus (strain TCF52B) GN=rpsM PE=3 SV=1 14 143 2.0E-12
sp|B9K8B1|RS13_THENN 30S ribosomal protein S13 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsM PE=3 SV=1 14 143 5.0E-12
sp|B3CT27|RS13_ORITI 30S ribosomal protein S13 OS=Orientia tsutsugamushi (strain Ikeda) GN=rpsM PE=3 SV=1 14 154 9.0E-12
sp|A5CCJ1|RS13_ORITB 30S ribosomal protein S13 OS=Orientia tsutsugamushi (strain Boryong) GN=rpsM PE=3 SV=1 16 154 9.0E-12
sp|Q73HA7|RS13_WOLPM 30S ribosomal protein S13 OS=Wolbachia pipientis wMel GN=rpsM PE=3 SV=1 14 147 1.0E-11
sp|B1LBL5|RS13_THESQ 30S ribosomal protein S13 OS=Thermotoga sp. (strain RQ2) GN=rpsM PE=3 SV=1 14 143 3.0E-11
sp|A5IMA8|RS13_THEP1 30S ribosomal protein S13 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsM PE=3 SV=1 14 143 3.0E-11
sp|Q9X1I5|RS13_THEMA 30S ribosomal protein S13 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsM PE=3 SV=1 14 143 3.0E-11
sp|A8ETK3|RS13_ARCB4 30S ribosomal protein S13 OS=Arcobacter butzleri (strain RM4018) GN=rpsM PE=3 SV=1 14 153 5.0E-11
sp|Q9Z7S6|RS13_CHLPN 30S ribosomal protein S13 OS=Chlamydia pneumoniae GN=rpsM PE=3 SV=1 16 143 5.0E-11
sp|A1QZT6|RS13_BORT9 30S ribosomal protein S13 OS=Borrelia turicatae (strain 91E135) GN=rpsM PE=3 SV=1 14 154 6.0E-11
sp|A7HM27|RS13_FERNB 30S ribosomal protein S13 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsM PE=3 SV=1 14 155 6.0E-11
sp|B5RPK4|RS13_BORRA 30S ribosomal protein S13 OS=Borrelia recurrentis (strain A1) GN=rpsM PE=3 SV=1 14 154 1.0E-10
sp|B5RM58|RS13_BORDL 30S ribosomal protein S13 OS=Borrelia duttonii (strain Ly) GN=rpsM PE=3 SV=1 14 154 1.0E-10
sp|Q4A5I8|RS13_MYCS5 30S ribosomal protein S13 OS=Mycoplasma synoviae (strain 53) GN=rpsM PE=3 SV=1 14 155 1.0E-10
sp|Q5L701|RS13_CHLAB 30S ribosomal protein S13 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsM PE=3 SV=1 16 143 1.0E-10
sp|B2S0K3|RS13_BORHD 30S ribosomal protein S13 OS=Borrelia hermsii (strain HS1 / DAH) GN=rpsM PE=3 SV=1 14 154 1.0E-10
sp|Q2RFS3|RS13_MOOTA 30S ribosomal protein S13 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsM PE=3 SV=1 14 154 2.0E-10
sp|B2UNG5|RS13_AKKM8 30S ribosomal protein S13 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpsM PE=3 SV=1 14 154 2.0E-10
sp|A6TWF6|RS13_ALKMQ 30S ribosomal protein S13 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsM PE=3 SV=1 14 154 2.0E-10
sp|Q252X2|RS13_CHLFF 30S ribosomal protein S13 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsM PE=3 SV=1 16 143 3.0E-10
sp|P59752|RS13_CHLCV 30S ribosomal protein S13 OS=Chlamydophila caviae (strain GPIC) GN=rpsM PE=3 SV=1 16 143 3.0E-10
sp|Q605D4|RS13_METCA 30S ribosomal protein S13 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsM PE=3 SV=1 14 143 4.0E-10
sp|Q3A6M3|RS13_PELCD 30S ribosomal protein S13 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsM PE=3 SV=1 14 143 4.0E-10
sp|A5IYW1|RS13_MYCAP 30S ribosomal protein S13 OS=Mycoplasma agalactiae (strain PG2) GN=rpsM PE=3 SV=1 14 143 4.0E-10
sp|B9MKF6|RS13_CALBD 30S ribosomal protein S13 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsM PE=3 SV=1 14 154 5.0E-10
sp|Q7UIC7|RS13_RHOBA 30S ribosomal protein S13 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsM PE=3 SV=1 16 155 5.0E-10
sp|B3PMM3|RS13_MYCA5 30S ribosomal protein S13 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpsM PE=3 SV=1 14 155 6.0E-10
sp|B8E1F7|RS13_DICTD 30S ribosomal protein S13 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsM PE=3 SV=1 14 154 6.0E-10
sp|Q0SN07|RS13_BORAP 30S ribosomal protein S13 OS=Borrelia afzelii (strain PKo) GN=rpsM PE=3 SV=1 14 154 6.0E-10
sp|A4XLQ5|RS13_CALS8 30S ribosomal protein S13 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsM PE=3 SV=1 14 154 7.0E-10
sp|B5YDW7|RS13_DICT6 30S ribosomal protein S13 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsM PE=3 SV=1 14 154 9.0E-10
sp|Q7VGC2|RS13_HELHP 30S ribosomal protein S13 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsM PE=3 SV=1 14 149 9.0E-10
sp|Q9PJN2|RS13_CHLMU 30S ribosomal protein S13 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsM PE=3 SV=1 16 143 1.0E-09
sp|Q3YRN0|RS13_EHRCJ 30S ribosomal protein S13 OS=Ehrlichia canis (strain Jake) GN=rpsM PE=3 SV=1 16 154 1.0E-09
sp|B0K5R8|RS13_THEPX 30S ribosomal protein S13 OS=Thermoanaerobacter sp. (strain X514) GN=rpsM PE=3 SV=1 14 154 1.0E-09
sp|B0KCM5|RS13_THEP3 30S ribosomal protein S13 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsM PE=3 SV=1 14 154 1.0E-09
sp|B0BCE8|RS13_CHLTB 30S ribosomal protein S13 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsM PE=3 SV=1 16 143 1.0E-09
sp|B0B883|RS13_CHLT2 30S ribosomal protein S13 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsM PE=3 SV=1 16 143 1.0E-09
sp|P0CE04|RS13_CHLTR 30S ribosomal protein S13 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsM PE=3 SV=1 16 143 1.0E-09
sp|Q3KLI8|RS13_CHLTA 30S ribosomal protein S13 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsM PE=3 SV=1 16 143 1.0E-09
sp|Q1RHP3|RS13_RICBR 30S ribosomal protein S13 OS=Rickettsia bellii (strain RML369-C) GN=rpsM PE=3 SV=1 16 154 1.0E-09
sp|A8GVD5|RS13_RICB8 30S ribosomal protein S13 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsM PE=3 SV=1 16 154 1.0E-09
sp|Q6ME44|RS13_PARUW 30S ribosomal protein S13 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsM PE=3 SV=1 16 154 1.0E-09
sp|Q2RQY2|RS13_RHORT 30S ribosomal protein S13 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsM PE=3 SV=1 14 143 1.0E-09
sp|Q5HAU3|RS13_EHRRW 30S ribosomal protein S13 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsM PE=3 SV=1 16 154 1.0E-09
sp|Q5FFR9|RS13_EHRRG 30S ribosomal protein S13 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsM PE=3 SV=1 16 154 1.0E-09
sp|Q2GH35|RS13_EHRCR 30S ribosomal protein S13 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsM PE=3 SV=1 16 154 1.0E-09
sp|B5ZB64|RS13_UREU1 30S ribosomal protein S13 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsM PE=3 SV=1 16 143 1.0E-09
sp|A8F4T6|RS13_PSELT 30S ribosomal protein S13 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsM PE=3 SV=1 14 143 2.0E-09
sp|A8GPC8|RS13_RICAH 30S ribosomal protein S13 OS=Rickettsia akari (strain Hartford) GN=rpsM PE=3 SV=1 14 154 2.0E-09
sp|Q9PQN6|RS13_UREPA 30S ribosomal protein S13 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsM PE=3 SV=1 16 143 2.0E-09
sp|B1AIP4|RS13_UREP2 30S ribosomal protein S13 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsM PE=3 SV=1 16 143 2.0E-09
sp|Q0ABF3|RS13_ALKEH 30S ribosomal protein S13 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsM PE=3 SV=1 14 143 2.0E-09
sp|A9KJG9|RS13_CLOPH 30S ribosomal protein S13 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsM PE=3 SV=1 14 143 2.0E-09
sp|Q6KI31|RS13_MYCMO 30S ribosomal protein S13 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsM PE=3 SV=1 16 155 3.0E-09
sp|Q3A9U1|RS13_CARHZ 30S ribosomal protein S13 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsM PE=3 SV=1 14 154 3.0E-09
sp|Q5GSW5|RS13_WOLTR 30S ribosomal protein S13 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsM PE=3 SV=1 16 147 3.0E-09
sp|Q8RE41|RS13_FUSNN 30S ribosomal protein S13 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsM PE=3 SV=1 16 143 3.0E-09
sp|O50632|RS13_BACHD 30S ribosomal protein S13 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsM PE=3 SV=1 14 143 3.0E-09
sp|Q5WZJ0|RS13_LEGPL 30S ribosomal protein S13 OS=Legionella pneumophila (strain Lens) GN=rpsM PE=3 SV=1 16 151 3.0E-09
sp|Q5ZYM1|RS13_LEGPH 30S ribosomal protein S13 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsM PE=3 SV=1 16 151 3.0E-09
sp|A5IHP4|RS13_LEGPC 30S ribosomal protein S13 OS=Legionella pneumophila (strain Corby) GN=rpsM PE=3 SV=1 16 151 3.0E-09
sp|Q5X837|RS13_LEGPA 30S ribosomal protein S13 OS=Legionella pneumophila (strain Paris) GN=rpsM PE=3 SV=1 16 151 3.0E-09
sp|Q68WA0|RS13_RICTY 30S ribosomal protein S13 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsM PE=3 SV=1 16 154 3.0E-09
sp|A8MLG6|RS13_ALKOO 30S ribosomal protein S13 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsM PE=3 SV=1 14 143 3.0E-09
sp|Q49ZE4|RS13_STAS1 30S ribosomal protein S13 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsM PE=3 SV=1 14 143 4.0E-09
sp|B5YG25|RS13_THEYD 30S ribosomal protein S13 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsM PE=3 SV=1 14 143 4.0E-09
sp|A3DJJ8|RS13_CLOTH 30S ribosomal protein S13 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsM PE=3 SV=1 14 154 4.0E-09
sp|B3EUJ9|RS13_AMOA5 30S ribosomal protein S13 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsM PE=3 SV=1 14 143 4.0E-09
sp|A8GT47|RS13_RICRS 30S ribosomal protein S13 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsM PE=3 SV=1 14 154 4.0E-09
sp|B0BUN8|RS13_RICRO 30S ribosomal protein S13 OS=Rickettsia rickettsii (strain Iowa) GN=rpsM PE=3 SV=1 14 154 4.0E-09
sp|Q9RDV8|RS13_MYCGA 30S ribosomal protein S13 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpsM PE=3 SV=3 14 143 5.0E-09
sp|Q4UMQ7|RS13_RICFE 30S ribosomal protein S13 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsM PE=3 SV=1 14 154 5.0E-09
sp|Q8EUD6|RS13_MYCPE 30S ribosomal protein S13 OS=Mycoplasma penetrans (strain HF-2) GN=rpsM PE=3 SV=1 14 143 6.0E-09
sp|B7J265|RS13_BORBZ 30S ribosomal protein S13 OS=Borrelia burgdorferi (strain ZS7) GN=rpsM PE=3 SV=1 14 154 6.0E-09
sp|O51453|RS13_BORBU 30S ribosomal protein S13 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsM PE=3 SV=3 14 154 6.0E-09
sp|A8F2C5|RS13_RICM5 30S ribosomal protein S13 OS=Rickettsia massiliae (strain Mtu5) GN=rpsM PE=3 SV=1 14 154 6.0E-09
sp|Q7M8F4|RS13_WOLSU 30S ribosomal protein S13 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsM PE=3 SV=1 14 153 8.0E-09
sp|Q661C0|RS13_BORBP 30S ribosomal protein S13 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsM PE=3 SV=1 14 154 8.0E-09
sp|B9E9L5|RS13_MACCJ 30S ribosomal protein S13 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsM PE=3 SV=1 14 143 8.0E-09
sp|O66486|RS13_AQUAE 30S ribosomal protein S13 OS=Aquifex aeolicus (strain VF5) GN=rpsM PE=3 SV=1 14 153 9.0E-09
sp|Q92GY8|RS13_RICCN 30S ribosomal protein S13 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsM PE=3 SV=1 14 154 1.0E-08
sp|C4ZBU3|RS13_EUBR3 30S ribosomal protein S13 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpsM PE=3 SV=1 14 143 1.0E-08
sp|C4K2F7|RS13_RICPU 30S ribosomal protein S13 OS=Rickettsia peacockii (strain Rustic) GN=rpsM PE=3 SV=1 14 154 1.0E-08
sp|C3PP85|RS13_RICAE 30S ribosomal protein S13 OS=Rickettsia africae (strain ESF-5) GN=rpsM PE=3 SV=1 14 154 1.0E-08
sp|Q8CRI3|RS13_STAES 30S ribosomal protein S13 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsM PE=3 SV=1 14 143 1.0E-08
sp|Q5HM23|RS13_STAEQ 30S ribosomal protein S13 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsM PE=3 SV=1 14 143 1.0E-08
sp|Q9ZCS7|RS13_RICPR 30S ribosomal protein S13 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsM PE=3 SV=1 16 154 1.0E-08
sp|C5BF29|RS13_EDWI9 30S ribosomal protein S13 OS=Edwardsiella ictaluri (strain 93-146) GN=rpsM PE=3 SV=1 14 143 1.0E-08
sp|Q8K971|RS13_BUCAP 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsM PE=3 SV=1 16 143 2.0E-08
sp|Q5FU05|RS13_GLUOX 30S ribosomal protein S13 OS=Gluconobacter oxydans (strain 621H) GN=rpsM PE=3 SV=1 14 154 2.0E-08
sp|A5EX97|RS13_DICNV 30S ribosomal protein S13 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsM PE=3 SV=1 14 143 2.0E-08
sp|B3QYE7|RS13_CHLT3 30S ribosomal protein S13 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpsM PE=3 SV=1 15 143 2.0E-08
sp|C5CGH7|RS13_KOSOT 30S ribosomal protein S13 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsM PE=3 SV=1 14 143 2.0E-08
sp|B5Y963|RS13_COPPD 30S ribosomal protein S13 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsM PE=3 SV=1 14 155 3.0E-08
sp|P56020|RS13_HELPY 30S ribosomal protein S13 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsM PE=3 SV=1 14 149 3.0E-08
sp|B2UV59|RS13_HELPS 30S ribosomal protein S13 OS=Helicobacter pylori (strain Shi470) GN=rpsM PE=3 SV=1 14 149 3.0E-08
sp|Q1CRW4|RS13_HELPH 30S ribosomal protein S13 OS=Helicobacter pylori (strain HPAG1) GN=rpsM PE=3 SV=1 14 149 3.0E-08
sp|B5Z8U5|RS13_HELPG 30S ribosomal protein S13 OS=Helicobacter pylori (strain G27) GN=rpsM PE=3 SV=1 14 149 3.0E-08
sp|B6JND6|RS13_HELP2 30S ribosomal protein S13 OS=Helicobacter pylori (strain P12) GN=rpsM PE=3 SV=1 14 149 3.0E-08
sp|A7H0Z2|RS13_CAMC5 30S ribosomal protein S13 OS=Campylobacter curvus (strain 525.92) GN=rpsM PE=3 SV=1 14 153 3.0E-08
sp|P26872|RT13_MARPO Ribosomal protein S13, mitochondrial OS=Marchantia polymorpha GN=RPS13 PE=3 SV=2 17 146 3.0E-08
sp|A9BFZ3|RS13_PETMO 30S ribosomal protein S13 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsM PE=3 SV=1 14 143 4.0E-08
sp|B0RZT3|RS13_FINM2 30S ribosomal protein S13 OS=Finegoldia magna (strain ATCC 29328) GN=rpsM PE=3 SV=1 14 143 4.0E-08
sp|B5ZZ55|RS13_RHILW 30S ribosomal protein S13 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsM PE=3 SV=1 14 154 4.0E-08
sp|Q8R7X9|RS13_CALS4 30S ribosomal protein S13 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsM PE=3 SV=1 14 154 5.0E-08
sp|P66389|RS13_STAAW 30S ribosomal protein S13 OS=Staphylococcus aureus (strain MW2) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|A8Z333|RS13_STAAT 30S ribosomal protein S13 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|Q6G795|RS13_STAAS 30S ribosomal protein S13 OS=Staphylococcus aureus (strain MSSA476) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|Q6GEK7|RS13_STAAR 30S ribosomal protein S13 OS=Staphylococcus aureus (strain MRSA252) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|P66388|RS13_STAAN 30S ribosomal protein S13 OS=Staphylococcus aureus (strain N315) GN=rpsM PE=1 SV=1 14 143 5.0E-08
sp|P66387|RS13_STAAM 30S ribosomal protein S13 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|A6QJ68|RS13_STAAE 30S ribosomal protein S13 OS=Staphylococcus aureus (strain Newman) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|Q5HDY2|RS13_STAAC 30S ribosomal protein S13 OS=Staphylococcus aureus (strain COL) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|Q2YYM0|RS13_STAAB 30S ribosomal protein S13 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|A5IV10|RS13_STAA9 30S ribosomal protein S13 OS=Staphylococcus aureus (strain JH9) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|Q2FW30|RS13_STAA8 30S ribosomal protein S13 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|Q2FER3|RS13_STAA3 30S ribosomal protein S13 OS=Staphylococcus aureus (strain USA300) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|A6U3V1|RS13_STAA2 30S ribosomal protein S13 OS=Staphylococcus aureus (strain JH1) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|A7X5C7|RS13_STAA1 30S ribosomal protein S13 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|A1JS04|RS13_YERE8 30S ribosomal protein S13 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsM PE=3 SV=1 14 143 5.0E-08
sp|A7ZFZ0|RS13_CAMC1 30S ribosomal protein S13 OS=Campylobacter concisus (strain 13826) GN=rpsM PE=3 SV=1 14 153 5.0E-08
sp|Q17ZB7|RS13_HELAH 30S ribosomal protein S13 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsM PE=3 SV=1 14 149 5.0E-08
sp|Q1MIB9|RS13_RHIL3 30S ribosomal protein S13 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsM PE=3 SV=1 14 154 5.0E-08
sp|Q50297|RS13_MYCPN 30S ribosomal protein S13 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsM PE=3 SV=1 14 143 6.0E-08
sp|A5D5E5|RS13_PELTS 30S ribosomal protein S13 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsM PE=3 SV=1 14 154 6.0E-08
sp|C4Z2V4|RS13_EUBE2 30S ribosomal protein S13 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=rpsM PE=3 SV=1 14 143 7.0E-08
sp|Q2N9D5|RS13_ERYLH 30S ribosomal protein S13 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsM PE=3 SV=1 14 154 7.0E-08
sp|Q3APJ7|RS13_CHLCH 30S ribosomal protein S13 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsM PE=3 SV=1 15 143 7.0E-08
sp|Q8D1Z0|RS13_WIGBR 30S ribosomal protein S13 OS=Wigglesworthia glossinidia brevipalpis GN=rpsM PE=3 SV=1 16 143 8.0E-08
sp|C3MB01|RS13_RHISN 30S ribosomal protein S13 OS=Rhizobium sp. (strain NGR234) GN=rpsM PE=3 SV=1 14 154 8.0E-08
sp|A9H3J7|RS13_GLUDA 30S ribosomal protein S13 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsM PE=3 SV=1 14 154 8.0E-08
sp|A7HBP2|RS13_ANADF 30S ribosomal protein S13 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsM PE=3 SV=1 14 143 8.0E-08
sp|B4U769|RS13_HYDS0 30S ribosomal protein S13 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpsM PE=3 SV=1 14 153 9.0E-08
sp|B6IRS8|RS13_RHOCS 30S ribosomal protein S13 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsM PE=3 SV=1 14 143 9.0E-08
sp|A5FZU3|RS13_ACICJ 30S ribosomal protein S13 OS=Acidiphilium cryptum (strain JF-5) GN=rpsM PE=3 SV=1 14 154 9.0E-08
sp|Q8UE39|RS13_AGRFC 30S ribosomal protein S13 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsM PE=3 SV=2 14 154 9.0E-08
sp|B9L6U0|RS13_NAUPA 30S ribosomal protein S13 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsM PE=3 SV=1 14 153 1.0E-07
sp|B9JDV0|RS13_AGRRK 30S ribosomal protein S13 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsM PE=3 SV=1 14 154 1.0E-07
sp|B9DM53|RS13_STACT 30S ribosomal protein S13 OS=Staphylococcus carnosus (strain TM300) GN=rpsM PE=3 SV=1 14 143 1.0E-07
sp|B4SBX1|RS13_PELPB 30S ribosomal protein S13 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsM PE=3 SV=1 15 143 1.0E-07
sp|Q4L890|RS13_STAHJ 30S ribosomal protein S13 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsM PE=3 SV=1 14 143 1.0E-07
sp|A6T3I1|RS13_JANMA 30S ribosomal protein S13 OS=Janthinobacterium sp. (strain Marseille) GN=rpsM PE=3 SV=1 14 143 1.0E-07
sp|B3PWU3|RS13_RHIE6 30S ribosomal protein S13 OS=Rhizobium etli (strain CIAT 652) GN=rpsM PE=3 SV=1 14 154 1.0E-07
sp|Q2K9J4|RS13_RHIEC 30S ribosomal protein S13 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsM PE=3 SV=1 14 154 1.0E-07
sp|B9JVQ9|RS13_AGRVS 30S ribosomal protein S13 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsM PE=3 SV=1 14 154 1.0E-07
sp|B8I805|RS13_CLOCE 30S ribosomal protein S13 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsM PE=3 SV=1 14 154 1.0E-07
sp|A6U881|RS13_SINMW 30S ribosomal protein S13 OS=Sinorhizobium medicae (strain WSM419) GN=rpsM PE=3 SV=1 14 154 1.0E-07
sp|Q2LQD2|RS13_SYNAS 30S ribosomal protein S13 OS=Syntrophus aciditrophicus (strain SB) GN=rpsM PE=3 SV=1 14 143 1.0E-07
sp|B5EM96|RS13_ACIF5 30S ribosomal protein S13 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsM PE=3 SV=1 14 143 1.0E-07
sp|B7J4A1|RS13_ACIF2 30S ribosomal protein S13 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsM PE=3 SV=1 14 143 1.0E-07
sp|Q6MJ33|RS13_BDEBA 30S ribosomal protein S13 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsM PE=3 SV=1 14 143 1.0E-07
sp|Q925X7|RS13_RHIME 30S ribosomal protein S13 OS=Rhizobium meliloti (strain 1021) GN=rpsM PE=3 SV=1 14 154 2.0E-07
sp|Q3ZZP9|RS13_DEHMC 30S ribosomal protein S13 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsM PE=3 SV=1 14 143 2.0E-07
sp|A5FRW9|RS13_DEHMB 30S ribosomal protein S13 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsM PE=3 SV=1 14 143 2.0E-07
sp|Q0AUK6|RS13_SYNWW 30S ribosomal protein S13 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsM PE=3 SV=1 14 143 2.0E-07
sp|Q12G80|RS13_POLSJ 30S ribosomal protein S13 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsM PE=3 SV=1 14 143 2.0E-07
sp|C6E4N3|RS13_GEOSM 30S ribosomal protein S13 OS=Geobacter sp. (strain M21) GN=rpsM PE=3 SV=1 14 153 2.0E-07
sp|B5EFS4|RS13_GEOBB 30S ribosomal protein S13 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsM PE=3 SV=1 14 153 2.0E-07
sp|Q3SLM7|RS13_THIDA 30S ribosomal protein S13 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsM PE=3 SV=1 14 143 2.0E-07
sp|Q2S3P2|RS13_SALRD 30S ribosomal protein S13 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsM PE=3 SV=1 14 143 2.0E-07
sp|Q057C6|RS13_BUCCC 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsM PE=3 SV=1 16 143 2.0E-07
sp|P20282|RS13_BACSU 30S ribosomal protein S13 OS=Bacillus subtilis (strain 168) GN=rpsM PE=1 SV=3 14 143 2.0E-07
sp|Q39KE4|RS13_BURL3 30S ribosomal protein S13 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|A0K3P8|RS13_BURCH 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|B1JU45|RS13_BURCC 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q1BRX1|RS13_BURCA 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q1IS97|RS13_KORVE 30S ribosomal protein S13 OS=Koribacter versatilis (strain Ellin345) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q65P81|RS13_BACLD 30S ribosomal protein S13 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q1GK06|RS13_RUEST 30S ribosomal protein S13 OS=Ruegeria sp. (strain TM1040) GN=rpsM PE=3 SV=1 14 154 3.0E-07
sp|B1JIY3|RS13_YERPY 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q664U3|RS13_YERPS 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|A4TH12|RS13_YERPP 30S ribosomal protein S13 OS=Yersinia pestis (strain Pestoides F) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q1CCW5|RS13_YERPN 30S ribosomal protein S13 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|A9R915|RS13_YERPG 30S ribosomal protein S13 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q8ZJ90|RS13_YERPE 30S ribosomal protein S13 OS=Yersinia pestis GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|B2K515|RS13_YERPB 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q1C2W8|RS13_YERPA 30S ribosomal protein S13 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|A7FNL3|RS13_YERP3 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q65QX7|RS13_MANSM 30S ribosomal protein S13 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q07KP0|RS13_RHOP5 30S ribosomal protein S13 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsM PE=3 SV=1 14 154 3.0E-07
sp|Q9ZJT2|RS13_HELPJ 30S ribosomal protein S13 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsM PE=3 SV=1 14 149 3.0E-07
sp|Q6CZZ2|RS13_PECAS 30S ribosomal protein S13 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|B0TC82|RS13_HELMI 30S ribosomal protein S13 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsM PE=3 SV=1 14 154 3.0E-07
sp|A9FGC9|RS13_SORC5 30S ribosomal protein S13 OS=Sorangium cellulosum (strain So ce56) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|A1W330|RS13_ACISJ 30S ribosomal protein S13 OS=Acidovorax sp. (strain JS42) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|B9MBV9|RS13_ACIET 30S ribosomal protein S13 OS=Acidovorax ebreus (strain TPSY) GN=rpsM PE=3 SV=1 14 143 3.0E-07
sp|Q5LW34|RS13_RUEPO 30S ribosomal protein S13 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsM PE=3 SV=1 14 154 3.0E-07
sp|B1I1M4|RS13_DESAP 30S ribosomal protein S13 OS=Desulforudis audaxviator (strain MP104C) GN=rpsM PE=3 SV=1 14 154 4.0E-07
sp|Q4FLN9|RS13_PELUB 30S ribosomal protein S13 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsM PE=3 SV=1 16 154 4.0E-07
sp|A9ADL6|RS13_BURM1 30S ribosomal protein S13 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsM PE=3 SV=1 14 143 4.0E-07
sp|B4E5E3|RS13_BURCJ 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsM PE=3 SV=1 14 143 4.0E-07
sp|A0T0Z2|RR13_THAPS 30S ribosomal protein S13, chloroplastic OS=Thalassiosira pseudonana GN=rps13 PE=3 SV=1 14 154 4.0E-07
sp|Q5WLN7|RS13_BACSK 30S ribosomal protein S13 OS=Bacillus clausii (strain KSM-K16) GN=rpsM PE=3 SV=1 14 143 4.0E-07
sp|Q0BYD6|RS13_HYPNA 30S ribosomal protein S13 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsM PE=3 SV=1 14 143 4.0E-07
sp|A9BRX2|RS13_DELAS 30S ribosomal protein S13 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsM PE=3 SV=1 14 143 4.0E-07
sp|Q7MYH2|RS13_PHOLL 30S ribosomal protein S13 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsM PE=3 SV=1 14 143 4.0E-07
sp|P49501|RR13_ODOSI 30S ribosomal protein S13, chloroplastic OS=Odontella sinensis GN=rps13 PE=3 SV=2 14 154 5.0E-07
sp|A4JAR3|RS13_BURVG 30S ribosomal protein S13 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsM PE=3 SV=1 14 143 5.0E-07
sp|Q0BJ23|RS13_BURCM 30S ribosomal protein S13 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsM PE=3 SV=1 14 143 5.0E-07
sp|B1YRQ2|RS13_BURA4 30S ribosomal protein S13 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsM PE=3 SV=1 14 143 5.0E-07
sp|Q21QP6|RS13_RHOFT 30S ribosomal protein S13 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsM PE=3 SV=1 14 143 5.0E-07
sp|A0RM33|RS13_CAMFF 30S ribosomal protein S13 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsM PE=3 SV=1 14 153 5.0E-07
sp|Q2YAX5|RS13_NITMU 30S ribosomal protein S13 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsM PE=3 SV=1 14 143 6.0E-07
sp|Q6N4V5|RS13_RHOPA 30S ribosomal protein S13 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsM PE=1 SV=3 4 154 6.0E-07
sp|A8F9B0|RS13_BACP2 30S ribosomal protein S13 OS=Bacillus pumilus (strain SAFR-032) GN=rpsM PE=3 SV=1 14 143 6.0E-07
sp|A6QCS1|RS13_SULNB 30S ribosomal protein S13 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsM PE=3 SV=1 14 151 6.0E-07
sp|Q67JW8|RS13_SYMTH 30S ribosomal protein S13 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsM PE=3 SV=1 14 143 6.0E-07
sp|A4SUY3|RS13_POLSQ 30S ribosomal protein S13 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsM PE=3 SV=1 14 143 7.0E-07
sp|Q18CI0|RS13_PEPD6 30S ribosomal protein S13 OS=Peptoclostridium difficile (strain 630) GN=rpsM PE=3 SV=1 14 154 7.0E-07
sp|Q6F1W9|RS13_MESFL 30S ribosomal protein S13 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsM PE=3 SV=1 14 143 7.0E-07
sp|Q2GEB8|RS13_NEOSM 30S ribosomal protein S13 OS=Neorickettsia sennetsu (strain Miyayama) GN=rpsM PE=3 SV=1 15 143 8.0E-07
sp|A7Z0R3|RS13_BACMF 30S ribosomal protein S13 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsM PE=3 SV=1 14 143 8.0E-07
sp|A0LIL4|RS13_SYNFM 30S ribosomal protein S13 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsM PE=3 SV=1 14 143 8.0E-07
sp|Q30TS6|RS13_SULDN 30S ribosomal protein S13 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsM PE=3 SV=1 14 151 9.0E-07
sp|A1W1J4|RS13_CAMJJ 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|C0ZIK5|RS13_BREBN 30S ribosomal protein S13 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|Q8KAJ5|RS13_CHLTE 30S ribosomal protein S13 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpsM PE=3 SV=1 15 143 1.0E-06
sp|B9M6F5|RS13_GEODF 30S ribosomal protein S13 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsM PE=3 SV=1 14 153 1.0E-06
sp|A4IJL2|RS13_GEOTN 30S ribosomal protein S13 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|Q5L3R4|RS13_GEOKA 30S ribosomal protein S13 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|B1GZA7|RS13_UNCTG 30S ribosomal protein S13 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpsM PE=3 SV=1 14 152 1.0E-06
sp|Q0ANS2|RS13_MARMM 30S ribosomal protein S13 OS=Maricaulis maris (strain MCS10) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|B9KLB3|RS13_RHOSK 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsM PE=3 SV=1 14 154 1.0E-06
sp|Q3J5Q0|RS13_RHOS4 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsM PE=3 SV=1 14 154 1.0E-06
sp|A3PGN3|RS13_RHOS1 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsM PE=3 SV=1 14 154 1.0E-06
sp|B3WAJ4|RS13_LACCB 30S ribosomal protein S13 OS=Lactobacillus casei (strain BL23) GN=rpsM PE=3 SV=1 24 154 1.0E-06
sp|Q035A7|RS13_LACC3 30S ribosomal protein S13 OS=Lactobacillus casei (strain ATCC 334) GN=rpsM PE=3 SV=1 24 154 1.0E-06
sp|Q28UT0|RS13_JANSC 30S ribosomal protein S13 OS=Jannaschia sp. (strain CCS1) GN=rpsM PE=3 SV=1 14 154 1.0E-06
sp|Q0BUM8|RS13_GRABC 30S ribosomal protein S13 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsM PE=3 SV=2 14 154 1.0E-06
sp|Q98Q06|RS13_MYCPU 30S ribosomal protein S13 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsM PE=3 SV=1 14 155 1.0E-06
sp|A1WVA0|RS13_HALHL 30S ribosomal protein S13 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|C4KZM1|RS13_EXISA 30S ribosomal protein S13 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|B4S5A4|RS13_PROA2 30S ribosomal protein S13 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsM PE=3 SV=1 15 143 1.0E-06
sp|B8G6Q1|RS13_CHLAD 30S ribosomal protein S13 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsM PE=3 SV=1 16 135 1.0E-06
sp|A4WVI6|RS13_RHOS5 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsM PE=3 SV=1 14 154 1.0E-06
sp|A7HWT3|RS13_PARL1 30S ribosomal protein S13 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsM PE=3 SV=1 14 154 1.0E-06
sp|A5GAU3|RS13_GEOUR 30S ribosomal protein S13 OS=Geobacter uraniireducens (strain Rf4) GN=rpsM PE=3 SV=1 14 153 1.0E-06
sp|Q2G5A8|RS13_NOVAD 30S ribosomal protein S13 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsM PE=3 SV=1 14 154 1.0E-06
sp|A1B050|RS13_PARDP 30S ribosomal protein S13 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsM PE=3 SV=2 14 143 1.0E-06
sp|Q3Z956|RS13_DEHM1 30S ribosomal protein S13 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsM PE=3 SV=1 14 143 1.0E-06
sp|B2G8V4|RS13_LACRJ 30S ribosomal protein S13 OS=Lactobacillus reuteri (strain JCM 1112) GN=rpsM PE=3 SV=1 14 154 2.0E-06
sp|A5VLI1|RS13_LACRD 30S ribosomal protein S13 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsM PE=3 SV=1 14 154 2.0E-06
sp|A0QSL5|RS13_MYCS2 30S ribosomal protein S13 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsM PE=1 SV=1 14 143 2.0E-06
sp|A9B434|RS13_HERA2 30S ribosomal protein S13 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpsM PE=3 SV=1 14 153 2.0E-06
sp|Q98N35|RS13_RHILO 30S ribosomal protein S13 OS=Rhizobium loti (strain MAFF303099) GN=rpsM PE=3 SV=1 14 154 2.0E-06
sp|B1YGX5|RS13_EXIS2 30S ribosomal protein S13 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsM PE=3 SV=1 14 143 2.0E-06
sp|A0ALU4|RS13_LISW6 30S ribosomal protein S13 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsM PE=3 SV=1 14 143 2.0E-06
sp|B2VK74|RS13_ERWT9 30S ribosomal protein S13 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsM PE=3 SV=1 16 143 2.0E-06
sp|Q8A499|RS13_BACTN 30S ribosomal protein S13 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsM PE=3 SV=1 13 154 2.0E-06
sp|Q1GVN4|RS13_SPHAL 30S ribosomal protein S13 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsM PE=3 SV=1 14 154 2.0E-06
sp|P23209|RT13_DAUCA Ribosomal protein S13, mitochondrial OS=Daucus carota GN=RPS13 PE=3 SV=1 14 146 2.0E-06
sp|A4J136|RS13_DESRM 30S ribosomal protein S13 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsM PE=3 SV=1 14 154 2.0E-06
sp|B9KZW3|RS13_THERP 30S ribosomal protein S13 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpsM PE=3 SV=1 14 143 2.0E-06
sp|A6KYH3|RS13_BACV8 30S ribosomal protein S13 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsM PE=3 SV=1 13 154 2.0E-06
sp|Q64NN2|RS13_BACFR 30S ribosomal protein S13 OS=Bacteroides fragilis (strain YCH46) GN=rpsM PE=3 SV=1 13 154 2.0E-06
sp|Q5L8D3|RS13_BACFN 30S ribosomal protein S13 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsM PE=3 SV=1 13 154 2.0E-06
sp|A0L5Z5|RS13_MAGMM 30S ribosomal protein S13 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsM PE=3 SV=1 14 143 2.0E-06
sp|A1TYL9|RS13_MARHV 30S ribosomal protein S13 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsM PE=3 SV=1 14 143 2.0E-06
sp|C5CQ78|RS13_VARPS 30S ribosomal protein S13 OS=Variovorax paradoxus (strain S110) GN=rpsM PE=3 SV=1 14 143 2.0E-06
sp|A8YXM8|RS13_LACH4 30S ribosomal protein S13 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|Q6YQZ7|RS13_ONYPE 30S ribosomal protein S13 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsM PE=3 SV=1 16 154 3.0E-06
sp|C5CC38|RS13_MICLC 30S ribosomal protein S13 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|P47421|RS13_MYCGE 30S ribosomal protein S13 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsM PE=3 SV=2 14 143 3.0E-06
sp|Q16AC0|RS13_ROSDO 30S ribosomal protein S13 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsM PE=3 SV=1 14 154 3.0E-06
sp|A5ELK5|RS13_BRASB 30S ribosomal protein S13 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsM PE=3 SV=1 16 154 3.0E-06
sp|B9KEH3|RS13_CAMLR 30S ribosomal protein S13 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|B9IZL9|RS13_BACCQ 30S ribosomal protein S13 OS=Bacillus cereus (strain Q1) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|A7GK45|RS13_BACCN 30S ribosomal protein S13 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|B7HQW9|RS13_BACC7 30S ribosomal protein S13 OS=Bacillus cereus (strain AH187) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|Q73F71|RS13_BACC1 30S ribosomal protein S13 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|Q2GL38|RS13_ANAPZ 30S ribosomal protein S13 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsM PE=3 SV=1 14 154 3.0E-06
sp|P66383|RS13_LISMO 30S ribosomal protein S13 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|B8DB32|RS13_LISMH 30S ribosomal protein S13 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|Q71WH0|RS13_LISMF 30S ribosomal protein S13 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|C1KZF7|RS13_LISMC 30S ribosomal protein S13 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|P66384|RS13_LISIN 30S ribosomal protein S13 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|A1TJT9|RS13_ACIAC 30S ribosomal protein S13 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|Q4JTB9|RS13_CORJK 30S ribosomal protein S13 OS=Corynebacterium jeikeium (strain K411) GN=rpsM PE=3 SV=1 14 143 3.0E-06
sp|Q03EE0|RS13_PEDPA 30S ribosomal protein S13 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsM PE=3 SV=1 14 154 3.0E-06
sp|A6TEV1|RS13_KLEP7 30S ribosomal protein S13 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsM PE=3 SV=1 16 143 3.0E-06
sp|B5XNB4|RS13_KLEP3 30S ribosomal protein S13 OS=Klebsiella pneumoniae (strain 342) GN=rpsM PE=3 SV=1 16 143 3.0E-06
sp|B3QR95|RS13_CHLP8 30S ribosomal protein S13 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsM PE=3 SV=1 15 143 3.0E-06
sp|Q05FK2|RS13_CARRP 30S ribosomal protein S13 OS=Carsonella ruddii (strain PV) GN=rpsM PE=3 SV=1 18 143 3.0E-06
sp|B3QBV7|RS13_RHOPT 30S ribosomal protein S13 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsM PE=3 SV=1 14 154 4.0E-06
sp|Q6FZE4|RS13_BARQU 30S ribosomal protein S13 OS=Bartonella quintana (strain Toulouse) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|Q6G2Y7|RS13_BARHE 30S ribosomal protein S13 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsM PE=3 SV=1 14 154 4.0E-06
sp|C6DFS6|RS13_PECCP 30S ribosomal protein S13 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|Q8Z1X6|RS13_SALTI 30S ribosomal protein S13 OS=Salmonella typhi GN=rpsM PE=3 SV=3 14 143 4.0E-06
sp|B7GJ92|RS13_ANOFW 30S ribosomal protein S13 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|Q6HPN4|RS13_BACHK 30S ribosomal protein S13 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|Q63H66|RS13_BACCZ 30S ribosomal protein S13 OS=Bacillus cereus (strain ZK / E33L) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|P62175|RS13_BACCR 30S ribosomal protein S13 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|B7HJ73|RS13_BACC4 30S ribosomal protein S13 OS=Bacillus cereus (strain B4264) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|C1ET64|RS13_BACC3 30S ribosomal protein S13 OS=Bacillus cereus (strain 03BB102) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|B7JKE5|RS13_BACC0 30S ribosomal protein S13 OS=Bacillus cereus (strain AH820) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|P62176|RS13_BACAN 30S ribosomal protein S13 OS=Bacillus anthracis GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|A0R8K4|RS13_BACAH 30S ribosomal protein S13 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|C3LJW9|RS13_BACAC 30S ribosomal protein S13 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|C3P9T0|RS13_BACAA 30S ribosomal protein S13 OS=Bacillus anthracis (strain A0248) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|Q5HSJ9|RS13_CAMJR 30S ribosomal protein S13 OS=Campylobacter jejuni (strain RM1221) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|Q9PM83|RS13_CAMJE 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|A7H5U2|RS13_CAMJD 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|A8FNQ4|RS13_CAMJ8 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|A4YSL4|RS13_BRASO 30S ribosomal protein S13 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsM PE=3 SV=1 16 154 4.0E-06
sp|Q89JA6|RS13_BRADU 30S ribosomal protein S13 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsM PE=3 SV=1 16 154 4.0E-06
sp|Q8ZLM1|RS13_SALTY 30S ribosomal protein S13 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsM PE=3 SV=3 14 143 4.0E-06
sp|Q5PK07|RS13_SALPA 30S ribosomal protein S13 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsM PE=3 SV=1 14 143 4.0E-06
sp|B2GDU5|RS13_LACF3 30S ribosomal protein S13 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpsM PE=3 SV=1 14 154 4.0E-06
sp|B8D0T4|RS13_HALOH 30S ribosomal protein S13 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsM PE=3 SV=1 14 154 5.0E-06
sp|Q3SSU4|RS13_NITWN 30S ribosomal protein S13 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsM PE=3 SV=1 14 154 5.0E-06
sp|Q2S934|RS13_HAHCH 30S ribosomal protein S13 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsM PE=3 SV=1 14 143 5.0E-06
sp|A4XZ68|RS13_PSEMY 30S ribosomal protein S13 OS=Pseudomonas mendocina (strain ymp) GN=rpsM PE=3 SV=1 14 143 5.0E-06
sp|A1WK95|RS13_VEREI 30S ribosomal protein S13 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsM PE=3 SV=1 14 143 5.0E-06
sp|Q8ETW0|RS13_OCEIH 30S ribosomal protein S13 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsM PE=3 SV=1 14 143 5.0E-06
sp|Q0I140|RS13_HAES1 30S ribosomal protein S13 OS=Haemophilus somnus (strain 129Pt) GN=rpsM PE=3 SV=1 14 143 5.0E-06
sp|Q250K7|RS13_DESHY 30S ribosomal protein S13 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsM PE=3 SV=1 14 154 6.0E-06
sp|B8G1Z1|RS13_DESHD 30S ribosomal protein S13 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsM PE=3 SV=1 14 154 6.0E-06
sp|B7IT44|RS13_BACC2 30S ribosomal protein S13 OS=Bacillus cereus (strain G9842) GN=rpsM PE=3 SV=1 14 143 6.0E-06
sp|P80377|RS13_THET8 30S ribosomal protein S13 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsM PE=1 SV=3 14 143 6.0E-06
sp|P62655|RS13_THET2 30S ribosomal protein S13 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsM PE=1 SV=2 14 143 6.0E-06
sp|B8D827|RS13_BUCAT 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsM PE=3 SV=1 16 143 6.0E-06
sp|P57569|RS13_BUCAI 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsM PE=3 SV=1 16 143 6.0E-06
sp|B8D9S5|RS13_BUCA5 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsM PE=3 SV=1 16 143 6.0E-06
sp|Q0VSI1|RS13_ALCBS 30S ribosomal protein S13 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsM PE=3 SV=1 14 143 6.0E-06
sp|Q0K642|RS13_CUPNH 30S ribosomal protein S13 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsM PE=3 SV=1 14 154 6.0E-06
sp|Q46WG6|RS13_CUPPJ 30S ribosomal protein S13 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsM PE=3 SV=1 14 154 6.0E-06
sp|B2IF93|RS13_BEII9 30S ribosomal protein S13 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsM PE=3 SV=1 16 154 6.0E-06
sp|B8EIT3|RS13_METSB 30S ribosomal protein S13 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsM PE=3 SV=1 14 154 7.0E-06
sp|P44380|RS13_HAEIN 30S ribosomal protein S13 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsM PE=3 SV=2 14 154 7.0E-06
sp|Q47J80|RS13_DECAR 30S ribosomal protein S13 OS=Dechloromonas aromatica (strain RCB) GN=rpsM PE=3 SV=1 14 143 7.0E-06
sp|B2S2F8|RS13_TREPS 30S ribosomal protein S13 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsM PE=3 SV=1 28 143 7.0E-06
sp|O83240|RS13_TREPA 30S ribosomal protein S13 OS=Treponema pallidum (strain Nichols) GN=rpsM PE=3 SV=1 28 143 7.0E-06
sp|A9VPA2|RS13_BACWK 30S ribosomal protein S13 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsM PE=3 SV=1 14 143 7.0E-06
sp|Q5Z1L2|RS13_NOCFA 30S ribosomal protein S13 OS=Nocardia farcinica (strain IFM 10152) GN=rpsM PE=3 SV=1 14 143 7.0E-06
sp|Q04BZ1|RS13_LACDB 30S ribosomal protein S13 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsM PE=3 SV=1 14 143 7.0E-06
sp|Q1GBJ4|RS13_LACDA 30S ribosomal protein S13 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsM PE=3 SV=1 14 143 7.0E-06
sp|O59772|SWS2_SCHPO 37S ribosomal protein subunit sws2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sws2 PE=3 SV=1 14 155 8.0E-06
sp|Q2IXN8|RS13_RHOP2 30S ribosomal protein S13 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsM PE=3 SV=1 14 154 8.0E-06
sp|A6Q1K1|RS13_NITSB 30S ribosomal protein S13 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsM PE=3 SV=1 14 143 8.0E-06
sp|A0PMB4|RS13_MYCUA 30S ribosomal protein S13 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsM PE=3 SV=1 14 143 8.0E-06
sp|B2HCX1|RS13_MYCMM 30S ribosomal protein S13 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsM PE=3 SV=1 14 143 8.0E-06
sp|Q1H4L4|RS13_METFK 30S ribosomal protein S13 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsM PE=3 SV=1 14 143 8.0E-06
sp|Q03PY1|RS13_LACBA 30S ribosomal protein S13 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsM PE=3 SV=1 14 154 8.0E-06
sp|B3R7E6|RS13_CUPTR 30S ribosomal protein S13 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsM PE=3 SV=1 14 154 9.0E-06
sp|Q1LI60|RS13_CUPMC 30S ribosomal protein S13 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsM PE=3 SV=1 14 154 9.0E-06
sp|A4G9R6|RS13_HERAR 30S ribosomal protein S13 OS=Herminiimonas arsenicoxydans GN=rpsM PE=3 SV=1 14 143 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0003723 RNA binding Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0005622 intracellular Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0043229 intracellular organelle No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:1990904 ribonucleoprotein complex No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1938
MSLVSGEKTNFQFILRLLNTNVDGKQKVMYALTKIKGVGRRYSNLVCKKADVDLNKRAGELTTEELERIVTIIQN
PTQYKIPSWFLNRQRDIVDGKDSQVLANGVDSKLREDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGRRGRTVGV
SKKKGG*
Coding >Hirsu2|1938
ATGTCGCTCGTCTCGGGAGAGAAGACGAACTTCCAGTTCATCTTGCGTCTTCTGAACACCAATGTCGACGGCAAG
CAAAAGGTCATGTACGCCTTGACCAAGATCAAGGGTGTCGGTCGCCGATACTCCAACTTGGTCTGCAAGAAGGCC
GACGTCGACCTGAACAAGCGTGCCGGTGAACTCACCACCGAGGAGCTCGAGCGGATCGTCACCATCATCCAGAAC
CCGACCCAGTACAAGATCCCGTCCTGGTTCCTCAACCGACAGCGCGACATCGTGGACGGCAAGGACTCGCAGGTG
CTCGCCAACGGCGTCGACTCCAAGCTGCGTGAGGACCTGGAGCGCCTCAAGAAGATCCGCGCCCACCGTGGTCTC
CGTCACTACTGGGGCCTCCGTGTCCGCGGCCAGCACACCAAGACGACCGGTCGCCGCGGCCGGACCGTCGGTGTG
TCCAAGAAGAAGGGTGGTTAA
Transcript >Hirsu2|1938
ATGTCGCTCGTCTCGGGAGAGAAGACGAACTTCCAGTTCATCTTGCGTCTTCTGAACACCAATGTCGACGGCAAG
CAAAAGGTCATGTACGCCTTGACCAAGATCAAGGGTGTCGGTCGCCGATACTCCAACTTGGTCTGCAAGAAGGCC
GACGTCGACCTGAACAAGCGTGCCGGTGAACTCACCACCGAGGAGCTCGAGCGGATCGTCACCATCATCCAGAAC
CCGACCCAGTACAAGATCCCGTCCTGGTTCCTCAACCGACAGCGCGACATCGTGGACGGCAAGGACTCGCAGGTG
CTCGCCAACGGCGTCGACTCCAAGCTGCGTGAGGACCTGGAGCGCCTCAAGAAGATCCGCGCCCACCGTGGTCTC
CGTCACTACTGGGGCCTCCGTGTCCGCGGCCAGCACACCAAGACGACCGGTCGCCGCGGCCGGACCGTCGGTGTG
TCCAAGAAGAAGGGTGGTTAA
Gene >Hirsu2|1938
ATGTCGCTCGTCTCGGGAGAGAAGACGAACTTCCAGTTCGTGAGTCTCTCTCTGCGTCCGCCGACGCGGCGGCCC
GGGCGCGGCATGGAAGCCGGACGACGGCATCGCGGCGCCCTCGTCCGCCGGCGTCTCGACACGGGGCTAACGCGC
GGCAACAGATCTTGCGTCTTCTGAACACCAATGTCGACGGCAAGCAAAAGGTCATGTACGCCTTGACCAAGATCA
AGGGTGTCGGTCGCCGATACTCCAACTTGGTCTGCAAGAAGGCCGACGTCGACCTGAACAAGCGGTACGTCGATT
CGCCAACACGGGGGGGGGGGGGGGAGGGGCAGTACCCATTGCCGCGGCGGAGACCCGACAGCTAACCTGATCTCG
GTCGCTGCAGTGCCGGTGAACTCACCACCGAGGAGCTCGAGCGGATCGTCACCATCATCCAGAACCCGACCCAGT
ACAAGATCCCGTCCTGGTTCCTCAACCGACAGCGCGACATCGTGGACGGCAAGGACTCGCAGGTGCTCGCCAACG
GCGTCGACTCCAAGCTGCGTGAGGACCTGGAGCGCCTCAAGAAGATCCGCGCCCACCGTGGTCTCCGTCACTACT
GGGGCCTCCGTGTCCGCGGCCAGCACACCAAGACGACCGGTCGCCGCGGCCGGACCGTCGGTGTGTCCAAGAAGA
AGGGTGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail