Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1936
Gene name
LocationContig_1442:5429..6646
Strand-
Gene length (bp)1217
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 1.2E-22 75 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 45 308 1.0E-38
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 45 308 2.0E-38
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 45 308 5.0E-38
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 45 332 5.0E-37
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 45 308 6.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 45 308 1.0E-38
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 45 308 2.0E-38
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 45 308 5.0E-38
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 45 332 5.0E-37
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 45 308 6.0E-35
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 47 308 3.0E-32
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 45 308 5.0E-31
sp|Q94EI9|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana GN=At3g14410 PE=2 SV=1 47 308 3.0E-29
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 47 338 4.0E-15
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 47 319 7.0E-15
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 77 314 1.0E-14
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 78 308 2.0E-11
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 80 308 4.0E-11
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 86 308 2.0E-08
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 72 304 3.0E-08
sp|Q69VR7|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT1 PE=2 SV=1 86 308 3.0E-08
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 77 307 4.0E-08
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 84 309 7.0E-08
sp|P52177|TPT1_BRAOB Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1 88 309 1.0E-07
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 88 309 2.0E-07
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 88 328 2.0E-07
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 77 304 3.0E-07
sp|Q8RXN3|PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=PPT1 PE=1 SV=1 86 308 3.0E-07
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 85 307 4.0E-07
sp|Q8H0T6|PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=PPT2 PE=2 SV=1 100 308 7.0E-07
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 106 331 1.0E-06
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 75 309 2.0E-06
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 88 308 2.0E-06
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 88 308 2.0E-06
sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 106 326 3.0E-06
sp|P29463|TPT_SOLTU Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1 88 308 5.0E-06
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 88 309 8.0E-06
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 144 308 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 110 132 22
3 145 167 22
4 202 224 22
5 236 258 22
6 263 285 22
7 294 316 22
8 336 358 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1936
MAPRLGRLQIPYVPNLLSLSPRFSPSNDQGAALEPADMCRLLAAILLTCWHLVFASAATQLLARTTPALDSRLAA
PMSPRRYAREVCPIGVFYAGSLVCSNLVYVHLSVAFIQMLKAAGPIAVLLVSWGWGLMKPSLSSFTQIMVIVAGV
AMASVGEMHFSLLGFCYQMAGNVLEAVRLVMIEVMLSDKGQGAAAAKMDPLVSLYYYAPISALMNFLVAVPTELP
RFQWHDVSRTGVSVLCLNALVAFMLNVASVFLIGKTSGLVMTLSSILKNILLIAVSLIIWNTSITLLQFVGYGIA
LAGLVYYSIGYDQLFATSQVLAKWTAAKLDSPHASASRRMIMLSAFASCLLLIFLLAARP*
Coding >Hirsu2|1936
ATGGCTCCTCGACTCGGCCGGCTTCAGATACCGTACGTCCCGAACCTCTTGTCCCTCTCCCCCCGCTTCTCCCCA
TCCAACGACCAGGGCGCGGCTCTGGAGCCCGCTGACATGTGCCGTCTCTTGGCAGCGATCCTGCTCACCTGCTGG
CACCTCGTGTTCGCGTCGGCGGCGACGCAGCTGCTGGCGCGGACGACGCCGGCGCTGGACTCGCGGCTGGCGGCG
CCGATGAGCCCGCGGCGGTACGCGCGCGAGGTCTGCCCGATTGGCGTCTTCTACGCCGGCTCGCTCGTGTGCTCC
AACCTCGTCTACGTGCACCTGTCGGTCGCCTTTATCCAGATGCTCAAGGCGGCCGGCCCGATCGCGGTCCTGCTG
GTCTCGTGGGGCTGGGGCCTGATGAAGCCGTCGCTGTCGTCCTTTACGCAGATCATGGTCATCGTCGCCGGCGTC
GCCATGGCCTCGGTCGGCGAGATGCACTTCTCGCTCCTCGGCTTCTGCTACCAGATGGCCGGCAACGTGCTGGAG
GCGGTCCGGCTCGTCATGATCGAGGTCATGCTTAGCGATAAGGGCCAGGGCGCCGCCGCCGCCAAGATGGACCCC
CTCGTCAGCCTGTACTACTACGCCCCCATCTCGGCCCTCATGAACTTCTTGGTCGCCGTCCCGACCGAGCTGCCG
CGCTTCCAGTGGCACGACGTCTCCCGCACGGGCGTCTCGGTCCTGTGCCTCAACGCCCTCGTGGCCTTCATGCTC
AACGTCGCCAGCGTCTTTCTGATCGGAAAGACGTCCGGCCTGGTCATGACCCTCTCCAGCATCCTCAAGAACATC
CTCCTCATCGCCGTCTCGCTCATCATATGGAACACCAGCATCACCCTGCTGCAGTTCGTCGGCTACGGCATCGCC
CTCGCCGGCCTCGTCTACTACTCCATCGGCTACGACCAGCTCTTCGCGACCTCCCAGGTCCTGGCCAAGTGGACG
GCCGCCAAGCTCGACTCTCCGCACGCCAGCGCGAGCCGCAGGATGATCATGCTGTCGGCCTTTGCCTCCTGCCTC
CTCTTGATATTTCTGCTTGCCGCGCGGCCTTAG
Transcript >Hirsu2|1936
ATGGCTCCTCGACTCGGCCGGCTTCAGATACCGTACGTCCCGAACCTCTTGTCCCTCTCCCCCCGCTTCTCCCCA
TCCAACGACCAGGGCGCGGCTCTGGAGCCCGCTGACATGTGCCGTCTCTTGGCAGCGATCCTGCTCACCTGCTGG
CACCTCGTGTTCGCGTCGGCGGCGACGCAGCTGCTGGCGCGGACGACGCCGGCGCTGGACTCGCGGCTGGCGGCG
CCGATGAGCCCGCGGCGGTACGCGCGCGAGGTCTGCCCGATTGGCGTCTTCTACGCCGGCTCGCTCGTGTGCTCC
AACCTCGTCTACGTGCACCTGTCGGTCGCCTTTATCCAGATGCTCAAGGCGGCCGGCCCGATCGCGGTCCTGCTG
GTCTCGTGGGGCTGGGGCCTGATGAAGCCGTCGCTGTCGTCCTTTACGCAGATCATGGTCATCGTCGCCGGCGTC
GCCATGGCCTCGGTCGGCGAGATGCACTTCTCGCTCCTCGGCTTCTGCTACCAGATGGCCGGCAACGTGCTGGAG
GCGGTCCGGCTCGTCATGATCGAGGTCATGCTTAGCGATAAGGGCCAGGGCGCCGCCGCCGCCAAGATGGACCCC
CTCGTCAGCCTGTACTACTACGCCCCCATCTCGGCCCTCATGAACTTCTTGGTCGCCGTCCCGACCGAGCTGCCG
CGCTTCCAGTGGCACGACGTCTCCCGCACGGGCGTCTCGGTCCTGTGCCTCAACGCCCTCGTGGCCTTCATGCTC
AACGTCGCCAGCGTCTTTCTGATCGGAAAGACGTCCGGCCTGGTCATGACCCTCTCCAGCATCCTCAAGAACATC
CTCCTCATCGCCGTCTCGCTCATCATATGGAACACCAGCATCACCCTGCTGCAGTTCGTCGGCTACGGCATCGCC
CTCGCCGGCCTCGTCTACTACTCCATCGGCTACGACCAGCTCTTCGCGACCTCCCAGGTCCTGGCCAAGTGGACG
GCCGCCAAGCTCGACTCTCCGCACGCCAGCGCGAGCCGCAGGATGATCATGCTGTCGGCCTTTGCCTCCTGCCTC
CTCTTGATATTTCTGCTTGCCGCGCGGCCTTAG
Gene >Hirsu2|1936
ATGGCTCCTCGACTCGGCCGGCTTCAGTAAGTCCAGCTCGTGGCAGATATCTACATCTCGAAACTCCGCCCGCTA
ACCGGTCGGCCGCAGGATACCGTACGTCCCGAACCTCTTGTCCCTCTCCCCCCGCTTCTCCCCATCCAACGACCA
GGGCGCGGCTCTGGAGCCCGCTGACATGTGCCGTCTCTTGGCAGCGATCCTGCTCACCTGCTGGCACCTCGTGTT
CGCGTCGGCGGCGACGCAGCTGCTGGCGCGGACGACGCCGGCGCTGGACTCGCGGCTGGCGGCGCCGATGAGCCC
GCGGCGGTACGCGCGCGAGGTCTGCCCGATTGGCGTCTTCTACGCCGGCTCGCTCGTGTGCTCCAACCTCGTCTA
CGTGCACCTGTCGGTCGCCTTTATCCAGATGCTCAAGGCGGCCGGCCCGATCGCGGTCCTGCTGGTCTCGTGGGG
CTGGGGCCTGATGAAGCCGTCGCTGTCGTCCTTTACGCAGATCATGGTCATCGTCGCCGGCGTCGCCATGGCCTC
GGTCGGCGAGATGCACTTCTCGCTCCTCGGCTTCTGCTACCAGATGGCCGGCAACGTGCTGGAGGCGGTCCGGCT
CGTCATGATCGAGGTCATGCTTAGCGATAAGGGCCAGGGCGCCGCCGCCGCCAAGATGGACCCCCTCGTCAGCCT
GTACTACTACGCCCCCATCTCGGCCCTCATGAACTTCTTGGTCGCCGTCCCGACCGAGCTGCCGCGCTTCCAGTG
GCACGACGTCTCCCGCACGGGCGTCTCGGTCCTGTGCCTCAACGCCCTCGTGGCCTTCATGCTCAACGTCGCCAG
CGTCTTTCTGGTGAGTCCCGGTTTTTTTTTCCCTTCGTCTCGAGACTTGGCCTCGGATCTGACCCTGTTGCCTGC
TGCAGATCGGAAAGACGTCCGGCCTGGTCATGACCCTCTCCAGCATCCTCAAGAACATCCTCCTCATCGCCGTCT
CGCTCATCATATGGAACACCAGCATCACCCTGCTGCAGTTCGTCGGCTACGGCATCGCCCTCGCCGGCCTCGTCT
ACTACTCCATCGGCTACGACCAGCTCTTCGCGACCTCCCAGGTCCTGGCCAAGTGGACGGCCGCCAAGCTCGACT
CTCCGCACGCCAGCGCGAGCCGCAGGATGATCATGCTGTCGGCCTTTGCCTCCTGCCTCCTCTTGATATTTCTGC
TTGCCGCGCGGCCTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail